Align Δ1-piperideine-6-carboxylate dehydrogenase (characterized)
to candidate Ga0059261_1006 Ga0059261_1006 NAD-dependent aldehyde dehydrogenases
Query= metacyc::MONOMER-12387 (496 letters) >FitnessBrowser__Korea:Ga0059261_1006 Length = 453 Score = 183 bits (465), Expect = 1e-50 Identities = 127/391 (32%), Positives = 186/391 (47%), Gaps = 19/391 (4%) Query: 38 HPLTGADLFGLRAHTPEDVDRAVEAAHTAFLTWRTTPAPVRGALVKRFGELLTEHKQDLA 97 +P TG A + ++ A+ A AF +WR + R AL+ + +K+ LA Sbjct: 6 NPATGEAGATFAALDDDAIEAALTRAEAAFRSWRASDIAQRTALLTAIADRFEANKRHLA 65 Query: 98 DLVTIEAGKIRSEALGEVQEMI----DICDFAVGLSRQLYGRTMPSERPGHRLMETWHPL 153 + T E GK + A+ EV++ I D G + +T GH W PL Sbjct: 66 ETATKEMGKTLASAIAEVEKCIAGFRHYADKGPGYLAPIETKTASGRAVGH-----WLPL 120 Query: 154 GVVGVISAFNFPV-AVWAWNAAVALVCGDTVVWKPSELTPLNRAACAALLDLAIADAGAP 212 G + + +NFP V W A ++ G+ + K + LT CAAL+ ++ AGAP Sbjct: 121 GPILAVMPWNFPYWQVVRW-LAPTILAGNVGLLKHASLTQ----GCAALIQQMVSAAGAP 175 Query: 213 KGLNQVVVGAADVGERLVDSPRVPLVSATGSTRMGRAVGPRVAARFGRTILELGGNNAAV 272 GL Q + +D R++ RV V+ TGS G V + +LELGG++ + Sbjct: 176 DGLFQNLPIKSDKVSRIIADTRVAAVTLTGSEGAGAKVAEAAGRALKKVVLELGGSDPFI 235 Query: 273 VTPSADLDLTVNAAVFAAAGTAGQRCTTLRRLIVHEDIADTVVERLTAAFERLPIGDPFQ 332 V PSADLD V AV A AGQ C +R+IVH D+ D +++ TAA + IGDP + Sbjct: 236 VMPSADLDKAVATAVKARVQNAGQSCICAKRMIVHADVYDAFLDKFTAAMLAVKIGDPME 295 Query: 333 DTTLVGPLVNEAAFGRMREAVERATAEGGTLCAGGERQFPDAAPGAYYVRPALVRMPAQT 392 D +GPL + + E VERA A+G TL G + + GA+ L + Sbjct: 296 DGVEMGPLSSVEQRDTVLEQVERAVADGATLAGGAKIE----RDGAWMEAGVLTHVHPDA 351 Query: 393 AVVREETFAPILYVLTYRDLDEAIRLNNEVP 423 +EE F P+ V D+D AI L N+VP Sbjct: 352 DFAQEEIFGPVAMVFRADDIDAAIALANDVP 382 Lambda K H 0.320 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 496 Length of database: 453 Length adjustment: 33 Effective length of query: 463 Effective length of database: 420 Effective search space: 194460 Effective search space used: 194460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory