Align Histidine transport ATP-binding protein HisP (characterized)
to candidate Ga0059261_2293 Ga0059261_2293 cell division ATP-binding protein FtsE
Query= SwissProt::P02915 (258 letters) >FitnessBrowser__Korea:Ga0059261_2293 Length = 235 Score = 118 bits (296), Expect = 1e-31 Identities = 71/221 (32%), Positives = 122/221 (55%), Gaps = 14/221 (6%) Query: 15 RYG-GHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLV 73 RYG G E L VS AG + G+SG+GK++ LR + ++P+ G + + G++ + Sbjct: 13 RYGTGAETLSDVSFTLSAGSFYFVTGASGAGKTSLLRLLYLAQRPTRGIVRLFGEDAGAL 72 Query: 74 RDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERA 133 K +L R R+ +VFQ F L H++ +NV P++V G+ + D Sbjct: 73 PRK----------RLPGFRRRIGVVFQDFRLLPHLSAYDNVA-LPLRVAGIPEADIEGPV 121 Query: 134 LKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVL 193 + +A VG+ +R K P LSGG+QQR++IARA+ P++L+ DEPT +DP++ +L Sbjct: 122 REMIAWVGLKDRDSAKPPT-LSGGEQQRIAIARAVITRPEILIADEPTGNVDPDMAERLL 180 Query: 194 RIMQQLAEEGKTMVVVTHEMG-FARHVSSHVIFLHQGKIEE 233 + L G T+VV TH+ +R + ++ + +G++ + Sbjct: 181 HLFDSLNRLGTTVVVATHDFQLISRIPDARMMRIEKGRLND 221 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 235 Length adjustment: 24 Effective length of query: 234 Effective length of database: 211 Effective search space: 49374 Effective search space used: 49374 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory