Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate Ga0059261_4131 Ga0059261_4131 Ornithine/acetylornithine aminotransferase
Query= SwissProt::Q5JEW1 (445 letters) >FitnessBrowser__Korea:Ga0059261_4131 Length = 398 Score = 173 bits (438), Expect = 1e-47 Identities = 137/419 (32%), Positives = 195/419 (46%), Gaps = 54/419 (12%) Query: 37 PIVIERGEGIRVYDVDGNVFY-DFASGVGVINVGHSHPRVVEAIKKQAEKFTHYS-LTDF 94 PI +RGEG +Y VDG Y D +GV +GH HP +V A++ QA K H S + + Sbjct: 13 PIAFDRGEGAWLYPVDGGEPYLDCVAGVATNALGHCHPVLVAALEAQAAKLWHISNMFEM 72 Query: 95 FYENAIILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLVK-YGTGRKQ-----FLAFY 148 +NA LAE+L + D V + NSG EA E A+K+ + Y R + + F Sbjct: 73 PGQNA--LAERLTTASFADT---VFFTNSGTEAVECAIKVARRYHAARGEPQRQTVIGFS 127 Query: 149 HAFHGRTQAVLSLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVL 208 AFHGRT ++ A DGF +PG H N W D T Sbjct: 128 GAFHGRTYGAMN-AAGNPAHLDGFGDRLPGFVHFAVDN-----WPALALAIADSAT---- 177 Query: 209 DFIEEYVFRHVPPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMG 268 A+ EP+QGEGG + F L+ +G+LL DEVQ G Sbjct: 178 ----------------AAVVVEPVQGEGGARAMTEPFLDKLRAACTAHGVLLIYDEVQTG 221 Query: 269 IGRTGKFWAIEHF-GVEPDLIQFGKAIGGGLPLAGVIHRADITFDK-PGRHATTFGGNPV 326 +GRTGK +A + + PD++ KA+G G P+ + A+ PG H TT GGNP+ Sbjct: 222 MGRTGKLFAHQWYPDATPDIMALAKALGSGFPVGACLATAEAASGMVPGVHGTTAGGNPL 281 Query: 327 AIAAGIEVV-EIVK-ELLPHVQEVGDYLHKYLEEFKEKYE-VIGDARGLGLAQAVEIVKS 383 A+A I EI K E L H +EV +L L+ + VI + RG GL V +V + Sbjct: 282 AMAVAIAAFDEIAKPETLTHAREVAQHLRAGLDRLAATHPGVISEIRGKGLLVGVRLVPN 341 Query: 384 KETKEKYPELRDRIVKESAKRGLVLLGCGDNSIRFIPPLIVTKEEIDVAMEIFEEALKA 442 + + ++ L++ G GDN +R +PPL +T E D ++ + A A Sbjct: 342 NRA----------FMAAAREQRLLVAGGGDNCVRLLPPLTLTVAEADQILDRLDTACHA 390 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 25 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 398 Length adjustment: 32 Effective length of query: 413 Effective length of database: 366 Effective search space: 151158 Effective search space used: 151158 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory