Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate Ga0059261_3874 Ga0059261_3874 ABC-type antimicrobial peptide transport system, ATPase component
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__Korea:Ga0059261_3874 Length = 243 Score = 121 bits (303), Expect = 2e-32 Identities = 78/229 (34%), Positives = 127/229 (55%), Gaps = 10/229 (4%) Query: 4 IIVKNVSKVFKKGKVVA--LDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGE 61 I + VSK + G+V L V++++ GE ++GPSG GK+T + I++GL +P GE Sbjct: 9 IDAREVSKSYTVGQVRTQILFGVSVSVMPGELTLVVGPSGCGKSTLLAILSGLTLPDQGE 68 Query: 62 LYFDDRLVASNGKLIVPPEDR----KIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEI 117 + D L ++ D G VFQ + L+ LTA E +A+ L MK+ E Sbjct: 69 V---DALGNPICRMKAGARDAFRLANTGFVFQGFNLFNALTAEEQVAYVLQCMKVKPAEA 125 Query: 118 RKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRD 177 R+R + + + + P ELSGG++QRVA+ARAL K P +L DEP S LD+ Sbjct: 126 RQRARAALEAVGLGPRMRLRPFELSGGEKQRVAIARALAKQPRILFADEPTSALDSHNGH 185 Query: 178 SARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPE 226 + AL++++ G +L V+HDP + + ADR+ + G++++ +P+ Sbjct: 186 AVIALLRDIAHNQGAAVLCVTHDPR-LLSFADRIIHMEDGRIIRDERPD 233 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 243 Length adjustment: 26 Effective length of query: 327 Effective length of database: 217 Effective search space: 70959 Effective search space used: 70959 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory