Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate Ga0059261_2669 Ga0059261_2669 Lactate dehydrogenase and related dehydrogenases
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__Korea:Ga0059261_2669 Length = 318 Score = 179 bits (453), Expect = 1e-49 Identities = 117/279 (41%), Positives = 151/279 (54%), Gaps = 16/279 (5%) Query: 31 QHDAFVAALKDADGGIGSSVKIT-PAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLA 89 +HDA + D +IT +L R + + GF+ D+ GI + Sbjct: 46 EHDALCPTVTD---------RITRDVILTEGRRARIIGNYGAGFEHIDLDAAREAGIAVT 96 Query: 90 NTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGL 149 NTPDVLT++TAD +LIL + RR E ++AG W L G ++GK LG+VG Sbjct: 97 NTPDVLTDATADIAMTLILMATRRAGEGERELRAGEWTGWRPTHLLGRSLRGKVLGLVGY 156 Query: 150 GRIGGAVARRAALGFNMKVLYTNRS-ANPQAEEAYGARRVELAELLATADFVCLQVPLTP 208 GRI AVA RA F MK+ +RS A E Y A L LL+ AD V L P Sbjct: 157 GRIARAVADRAK-AFGMKIAVHSRSRAEDVPETDYHA---SLQSLLSIADVVSLHAPGGA 212 Query: 209 ETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLPSDS 268 T+H+I AA L +MK+ A+L+N RG +DE AL EAL+ GTI AGLDV+E EP ++ Sbjct: 213 ATRHMIDAAALSAMKRDAVLVNTGRGTLIDEAALAEALKVGTIAAAGLDVYEREP-AVEA 271 Query: 269 PLLKLANVVALPHIGSATHETRHAMARNAAENLVAALDG 307 L+ L N V LPH GSAT ETR AM A+NL A G Sbjct: 272 ALIDLPNAVLLPHFGSATLETREAMGMKVADNLDAFFAG 310 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 318 Length adjustment: 28 Effective length of query: 293 Effective length of database: 290 Effective search space: 84970 Effective search space used: 84970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory