Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate Ga0059261_0494 Ga0059261_0494 ABC-type antimicrobial peptide transport system, ATPase component
Query= reanno::psRCH2:GFF857 (371 letters) >FitnessBrowser__Korea:Ga0059261_0494 Length = 218 Score = 109 bits (272), Expect = 8e-29 Identities = 73/202 (36%), Positives = 107/202 (52%), Gaps = 19/202 (9%) Query: 1 MASVTLRDICKSYDGTPITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGDL 60 ++S+T R Y G + DL E G+ V +GPSG GK+TL+ LIAGL SG + Sbjct: 7 ISSLTFR-----YGGQAVVDGFDLVQEPGDHRVLLGPSGSGKTTLINLIAGLLTPQSGRI 61 Query: 61 LIDNQRVNDLPP------KDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRV 114 +ID + + DLP + R +G+VFQ+ L + V N+ +LA +R + + Sbjct: 62 MIDGESIGDLPAAKRDDLRRRKIGVVFQTLRLVAALDVTANLMLAQRLAG--QRPDRGEI 119 Query: 115 EAVAEILQLDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLD---AFLRVQ 171 +A+ L L +P++LS G+ QR AI R +V PK+ + DEP S LD A Q Sbjct: 120 QALLAALDLTHRAHARPRELSQGEAQRAAIARGLVAHPKLLIADEPTSALDDCNAERVAQ 179 Query: 172 MRIEIARLHQRIRSTMIYVTHD 193 + IE A H ST++ THD Sbjct: 180 LLIETANTH---GSTLLVATHD 198 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 218 Length adjustment: 26 Effective length of query: 345 Effective length of database: 192 Effective search space: 66240 Effective search space used: 66240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory