Align Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate Ga0059261_0562 Ga0059261_0562 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component
Query= SwissProt::P19566 (369 letters) >FitnessBrowser__Korea:Ga0059261_0562 Length = 232 Score = 108 bits (271), Expect = 1e-28 Identities = 72/223 (32%), Positives = 115/223 (51%), Gaps = 18/223 (8%) Query: 3 SVQLRNVTKAWGD----VVVSKDINLDIHDGEFVVFVGPSGCGKSTLLRMIAGLETITSG 58 +++ RNVT G + K I++DI G V +GPSG GKS+L+ +++GLE + G Sbjct: 10 AIRARNVTLTLGTREAPTEILKGIDVDIARGSSVAILGPSGSGKSSLMAILSGLERASGG 69 Query: 59 DLFI-----GETRMNDIPPAERG-VGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVMNQ 112 ++ + G + + A RG VG+V Q++ L P ++ EN++ L+LAGA Sbjct: 70 EVSVAGIAYGTLDEDGLARARRGRVGIVLQAFHLLPTMTAHENVAVPLELAGAPDAFA-- 127 Query: 113 RVNQVAEVLQLAHLLERKPKALSGGQRQRVAIGRTLVAEPRVFLLDEPLSNLDAALRVQM 172 R + + L H L P LSGG++QRVAI R + P + DEP NLD A + Sbjct: 128 RAGAELDAVGLGHRLTHYPVQLSGGEQQRVAIARAVAGRPEILFADEPTGNLDGATSGAI 187 Query: 173 RIEISRLHKRLGRTMIYVTHDQVEA------MTLADKIVVLDA 209 + + T++ +THD A +T+ D ++V D+ Sbjct: 188 VDLLFDRQRAADATLLIITHDPALAERCDRVLTMRDGLIVADS 230 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 232 Length adjustment: 26 Effective length of query: 343 Effective length of database: 206 Effective search space: 70658 Effective search space used: 70658 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory