Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate Ga0059261_0341 Ga0059261_0341 ABC-type antimicrobial peptide transport system, ATPase component
Query= uniprot:Q6MNM2 (347 letters) >FitnessBrowser__Korea:Ga0059261_0341 Length = 224 Score = 125 bits (315), Expect = 8e-34 Identities = 77/220 (35%), Positives = 118/220 (53%), Gaps = 11/220 (5%) Query: 4 IQFSNIKKSF--GSAD--VLKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSGT 59 +Q S +K++F G AD VL+GIDL + GE + L+GPSG GKSTLL+ + LE G+ Sbjct: 6 LQTSGLKRTFSQGGADIHVLRGIDLTVGQGEIVALLGPSGSGKSTLLQAVGLLEGGFEGS 65 Query: 60 ISIDGKKINDIEPQNRDIA------MVFQSYALYPHMTVAENMGFGLKLKNLAAAEITKR 113 I I G ++ +E R + V+Q + L P EN+ ++N A+ R Sbjct: 66 IRISGVEVGKLESHARTVTRRDKLGFVYQFHHLLPDFNALENVELPQLIQNATLADARAR 125 Query: 114 VNEISELLQIKHLLDRKPKELSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQMR 173 + L + L +P +LSGG++QRVA+ RAL+ + ++L DEP NLD H + Sbjct: 126 SEGLLTALGLGARLTHRPSQLSGGEQQRVAVARALANRPALVLADEPTGNLDEHTADIVL 185 Query: 174 LEIKRLHHNSKSTMIYVTHDQMEATTLGDRIAVLKDGVIE 213 E RL + + TH++ A + DR+ L +GV+E Sbjct: 186 AEFLRLVRGEGAAALIATHNERLAAKM-DRVVRLHEGVLE 224 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 224 Length adjustment: 25 Effective length of query: 322 Effective length of database: 199 Effective search space: 64078 Effective search space used: 64078 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory