GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ptsG in Sphingomonas koreensis DSMZ 15582

Align PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized)
to candidate Ga0059261_1647 Ga0059261_1647 PTS system, N-acetylglucosamine-specific IIBC component

Query= SwissProt::P37439
         (477 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_1647 Ga0059261_1647 PTS system,
           N-acetylglucosamine-specific IIBC component
          Length = 560

 Score =  349 bits (895), Expect = e-100
 Identities = 204/481 (42%), Positives = 292/481 (60%), Gaps = 32/481 (6%)

Query: 9   LQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPAVVSHVMAEAGGSVFANMPLIFAIGVA 68
           LQ +G++LMLP++VLP+AG+LL +G  +   +  V     + AG ++F N+ ++FAIGVA
Sbjct: 8   LQPLGRALMLPIAVLPVAGLLLRIGQPDLLDIAFV-----SAAGTAIFGNLGILFAIGVA 62

Query: 69  LGFTNN-DGVSALAAVVAYGIMV---KTMAVVAP-LVLHLPAEEIAAKHLADTGVLG--- 120
           +GF  + +G +ALA V  Y +     +T  +  P +V  LP  + AAK +A     G   
Sbjct: 63  VGFARDGNGAAALAGVTCYLVSTTGAQTFLIAPPEVVAGLP--DAAAKVVAQAWATGQID 120

Query: 121 ------GIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFVWPP 174
                 GIISG I    +NRF  I LPEYL FF G+RFVPI +G+A +    VL + +  
Sbjct: 121 RLEVPIGIISGLIGGKFYNRFATIALPEYLAFFGGRRFVPIAAGIAGLLLAGVLGYGYAH 180

Query: 175 IGTAIQAFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQVFH 234
           I +A+ A S  A  ++      +YG + R L+  GLHH+ N      +G++  A G    
Sbjct: 181 ISSALDAASH-AVVESGGAGMFVYGVLNRLLLVTGLHHLLNNVAWFLVGDFGGATG---- 235

Query: 235 GDIPRYMAGDPTAG-MLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFL 293
            D+ R+ AGDP AG  +SG F   M+GLPAA +A++H A+PE R  VGG++ S A TSFL
Sbjct: 236 -DLGRFFAGDPNAGAFMSGFFPVMMFGLPAACLAMYHEARPERRKAVGGMLFSLAFTSFL 294

Query: 294 TGITEPIEFSFMFVAPILYIIHAILAGLAFPICILLGMRDGTSFSHGLIDFIVLSGNSSK 353
           TG+TEPIEF+FMF+AP+LY IHA+L G+A  +  +LG++ G  FS GL D+++    S++
Sbjct: 295 TGVTEPIEFTFMFLAPVLYAIHAVLTGVAMTLMDMLGIKLGFGFSAGLFDYVLNFKLSTR 354

Query: 354 LWLFPIVGAGYAIVYYTVFRVLIKALDLKTPGREDTTDDAKAGAT---SEMAPALVAAFG 410
            W+   VGA YA++YYT+FR  I+ LDL TPGRE     A AG T   +E   A V A G
Sbjct: 355 PWMLLPVGAAYAVIYYTLFRFFIRKLDLATPGREKGEAVAAAGETAAGNERGAAFVKALG 414

Query: 411 GKENITNLDACITRLRVSVADVAKVDQAGLKKLGAAGVV-VAGSGVQAIFGTKSDNLKTE 469
           G  N+T++DAC TRLR+ VAD + VD A L  LGA G++  + +  Q + G  +D +  E
Sbjct: 415 GAANLTSVDACTTRLRLIVADQSAVDDAALNALGARGIIRPSANATQVVLGPIADLVAEE 474

Query: 470 M 470
           +
Sbjct: 475 I 475


Lambda     K      H
   0.325    0.140    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 835
Number of extensions: 59
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 477
Length of database: 560
Length adjustment: 35
Effective length of query: 442
Effective length of database: 525
Effective search space:   232050
Effective search space used:   232050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory