Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate Ga0059261_1321 Ga0059261_1321 ABC-type antimicrobial peptide transport system, ATPase component
Query= TCDB::P54933 (332 letters) >FitnessBrowser__Korea:Ga0059261_1321 Length = 238 Score = 115 bits (289), Expect = 8e-31 Identities = 78/223 (34%), Positives = 117/223 (52%), Gaps = 15/223 (6%) Query: 4 ITLRNVQKRFGEAVV----IPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQ 59 I LRN+ K FGE + +DLDI + +FV +GPSG GKST + ++ L+ + G+ Sbjct: 8 IRLRNITKVFGEGATAFQALKGVDLDIAERDFVAVMGPSGSGKSTTMNILGCLDVPTSGE 67 Query: 60 IMIDG-------RDATEMPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIER 112 + G RD + K L VFQ + L +N+ PL + + E +++ Sbjct: 68 FLFKGVYIETLDRDQRALVRRKY-LGFVFQGFNLLSRTNALENVELPL-LYRGEDKKVRH 125 Query: 113 RVSNAA-KILNLTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVN 171 + AA + + L ++ D P +LSGGQ QRVAI RAIV PA L DEP NLD+A V Sbjct: 126 ELGMAALEKVGLADWWDHTPAELSGGQPQRVAIARAIVTSPAVLLADEPTGNLDSARSVE 185 Query: 172 MRLEITELHQSLETTMIYVTHDQVEAMTMADKIVVLNAGRIEQ 214 + +T L++ T++ VTH+ + A IV G +E+ Sbjct: 186 IMELLTSLNKDSGITVLMVTHEP-DMAAFARTIVHFKDGLVER 227 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 238 Length adjustment: 26 Effective length of query: 306 Effective length of database: 212 Effective search space: 64872 Effective search space used: 64872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory