Align ABC transporter for D-mannitol and D-mannose, ATPase component (characterized)
to candidate Ga0059261_3874 Ga0059261_3874 ABC-type antimicrobial peptide transport system, ATPase component
Query= reanno::pseudo3_N2E3:AO353_25895 (367 letters) >FitnessBrowser__Korea:Ga0059261_3874 Length = 243 Score = 114 bits (284), Expect = 4e-30 Identities = 66/201 (32%), Positives = 106/201 (52%), Gaps = 7/201 (3%) Query: 18 IIKGIDLEVNDREFVVFVGPSGCGKSTLLRLIAGLEEVTAGTIELDGRDITEVSPAKRDL 77 I+ G+ + V E + VGPSGCGKSTLL +++GL G ++ G I + RD Sbjct: 27 ILFGVSVSVMPGELTLVVGPSGCGKSTLLAILSGLTLPDQGEVDALGNPICRMKAGARDA 86 Query: 78 ------AMVFQTYALYPHMSVRKNMSFALDLAGVNKAEVEKKVNEAARILELGPMLERKP 131 VFQ + L+ ++ + +++ L V AE ++ A + LGP + +P Sbjct: 87 FRLANTGFVFQGFNLFNALTAEEQVAYVLQCMKVKPAEARQRARAALEAVGLGPRMRLRP 146 Query: 132 KQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARLHKELQATMIYVT 191 +LSGG++QRVAI RA+ + P+I DEP S LD+ + L + A ++ VT Sbjct: 147 FELSGGEKQRVAIARALAKQPRILFADEPTSALDSHNGHAVIALLRDIAHNQGAAVLCVT 206 Query: 192 HDQVEAMTLADKVVVLNGGRI 212 HD ++ AD+++ + GRI Sbjct: 207 HDP-RLLSFADRIIHMEDGRI 226 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 243 Length adjustment: 27 Effective length of query: 340 Effective length of database: 216 Effective search space: 73440 Effective search space used: 73440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory