GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gluP in Sphingomonas koreensis DSMZ 15582

Align D-mannitol and D-mannose transporter (MFS superfamily) (characterized)
to candidate Ga0059261_0767 Ga0059261_0767 glucose/galactose transporter

Query= reanno::SB2B:6936374
         (413 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_0767 Ga0059261_0767
           glucose/galactose transporter
          Length = 434

 Score =  336 bits (862), Expect = 7e-97
 Identities = 194/431 (45%), Positives = 268/431 (62%), Gaps = 27/431 (6%)

Query: 4   VSSTTPQNGSAAPAQSHQQLLFGAMTSLFFIWGFITALNDILIPHLKGIFDLSYTQAMLV 63
           +SST P +G A    +    +F  + +LFFI+G IT+LND++IP LK +F L+YTQAMLV
Sbjct: 8   LSSTDPASGDAQGINAPDLQVF--VFALFFIFGGITSLNDVIIPKLKELFTLNYTQAMLV 65

Query: 64  QFCFFGAYFLVSPLAGVLIARIGYLRGIIFGLSTMATGCLLFYPASSLEQYALFLLALFV 123
           QFCFF AY ++      L+ ++GY+RG + GL TM  GCLLF PAS    Y +FL ALFV
Sbjct: 66  QFCFFTAYLVIGIPGAKLVKKLGYMRGAVAGLLTMMVGCLLFIPASQYATYGVFLFALFV 125

Query: 124 LASGITILQVSANPFVARLGPERTAASRLNLAQALNSLGHTLGPLFGSLLIFGAAA---- 179
           LASG+ I+QV ANP ++ LG   TA SRL  AQA NSLG T+ P+ GS+LI G+ A    
Sbjct: 126 LASGVVIVQVVANPLISLLGKPETAHSRLTFAQAFNSLGTTVFPIVGSILILGSLATVTA 185

Query: 180 -------------GTHEAVQLPYLLLAAVIGIIA-VGFIF---LGGKVKHADMGVDHRHK 222
                           +A+   YL +AA + ++A V ++F   L G+   A  G+     
Sbjct: 186 DQLSGPALEAYRVAESKAIMHGYLGIAAALAVVAGVVWLFRNRLKGERHQASAGLAGL-- 243

Query: 223 GSLLSHKRLLLGALAIFLYVGAEVSIGSFLVNYFAEPSIGGLDEKSAAELVSWYWGGAMI 282
             LL   R   GAL IFLYVGAEVSIGS +VNY  +P + GL E++A +L+ +YWGGAM+
Sbjct: 244 -DLLGRPRFGFGALCIFLYVGAEVSIGSLIVNYLMQPGVMGLQEQAAGKLIGFYWGGAMV 302

Query: 283 GRFAGAALTRRFNPAMVLAANAVFANLLLMLTIVSSGELALVAVLAVGFFNSIMFPTIFT 342
           GRF G+ L R  +P  +LA  AV A  L++++  ++G +A  ++LA+G  NSIMFPTIF+
Sbjct: 303 GRFIGSGLMRVISPGKLLAFVAVGAVALILISTNTTGHVAGYSLLAIGLMNSIMFPTIFS 362

Query: 343 LAIEGLGELTSRGSGLLCQAIVGGALLPVIQGVVADNVG-VQLSFIVPTFCYFYICWYAF 401
           LA E LG   + GSG++  AI GGA++P+  G +AD  G + L+ I+P  CY  I  + +
Sbjct: 363 LASEKLGGRAADGSGIINIAIFGGAVVPLATGALADATGSLGLALILPAICYAIIAGFGY 422

Query: 402 FARNRMNGETA 412
           +AR    G  A
Sbjct: 423 YARRPYAGPVA 433


Lambda     K      H
   0.329    0.142    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 510
Number of extensions: 28
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 413
Length of database: 434
Length adjustment: 32
Effective length of query: 381
Effective length of database: 402
Effective search space:   153162
Effective search space used:   153162
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory