Align Sodium/myo-inositol cotransporter 2; Na(+)/myo-inositol cotransporter 2; Sodium-dependent glucose cotransporter; Sodium/glucose cotransporter KST1; rKST1; Sodium/myo-inositol transporter 2; SMIT2; Solute carrier family 5 member 11 (characterized)
to candidate Ga0059261_1623 Ga0059261_1623 transporter, SSS family
Query= SwissProt::Q28728 (674 letters) >FitnessBrowser__Korea:Ga0059261_1623 Length = 549 Score = 260 bits (664), Expect = 1e-73 Identities = 169/496 (34%), Positives = 271/496 (54%), Gaps = 55/496 (11%) Query: 23 SLEPGDIAVLVLYFLFVLAVGLWSTVKTK---RDTVKGYFLAGGDMVWWPVGASLFASNV 79 SL D+ V+++Y + + A+ W + + +DT YFLA + WW +GASL A+N+ Sbjct: 3 SLSHIDLIVVIVYAIGIFALAQWVSREKAGHAKDT-SDYFLASKSLPWWAIGASLIAANI 61 Query: 80 GSGHFVGLAGSGAATGISVAAYEFNGMFSVLMLAWIFLPIYIAGQVTTMPEYLRRRFGGS 139 + VG++GSG A G+++A+YE+ ++L++ FLPI++ ++ TMP++L +RFG + Sbjct: 62 SAEQIVGMSGSGYAIGLAIASYEWMAALTLLIVGKWFLPIFLKNEIYTMPQFLEQRFGPT 121 Query: 140 RIAITLAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLSVVGLLAVTALYTVAGGLAA 199 I +AV +L +YIF ++ ++ G+I + Q +D +++ GL A +Y + GGL A Sbjct: 122 -IRTVMAVFWLALYIFVNLTSILWLGSIAVTQVAGVDQDIALFGLGAFALVYQLRGGLKA 180 Query: 200 VIYTDALQTLIMLVGALTLMGYSFAAVGGMEGLQEKYFLALPSNRSENSSCGLPREDAFH 259 V TD +Q ++++G L + + + +GG G+ + + LP + Sbjct: 181 VALTDIVQVTLLVLGGLVISYLTLSKIGGDAGVMGGF---------TRLTTELPGKFDMI 231 Query: 260 LFRD-PLTSDLPWPGILF-GMSIPSLWYWCTDQVIVQRSLAAKNLSHAKGGSLMAAYLKV 317 L D P DLP +L GM I +L YW +Q I+QR+LAAK+LS A+ G + AA+LK+ Sbjct: 232 LAPDNPFYKDLPGLSVLIGGMWIANLSYWGFNQYIIQRALAAKSLSEAQKGVVFAAFLKL 291 Query: 318 LPLFIMVFPGMVSRILFPDQVACADPETCQRVCNNPSGCSDIAYPKLVLELLPTGLRGLM 377 L I+V PG+ + IL PD A P D AYP + + LLP GL GL+ Sbjct: 292 LMPVIIVLPGIAAVILAPD---LAKP--------------DQAYPTM-MRLLPVGLLGLV 333 Query: 378 MAVMVAALMSSLTSIFNSASTIFTMDLWNHVR--------------------PRASEKEL 417 A +VAA+++S S NS +TIFT+DL+ + A EK+L Sbjct: 334 FAALVAAIIASTASKINSIATIFTLDLYAKAKGVQSRAQDAATASASGDSGLTAAHEKQL 393 Query: 418 MIVGRVFVLLLVLVSVLWIPVVQASQGGQLFVYIQAISSYLQPPVAMVFVLGCFWKRANE 477 + VGR ++ L+++ + S Q F YIQ S ++ P + ++F+LG FW RA E Sbjct: 394 VRVGRTTAVVATLLAIFTARPLLGSL-DQAFQYIQEFSGFVTPGITVIFLLGLFWPRATE 452 Query: 478 KGAFWGLVLGLLLGFI 493 GA G V +LL F+ Sbjct: 453 AGALTGAVASVLLSFL 468 Lambda K H 0.325 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 742 Number of extensions: 38 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 674 Length of database: 549 Length adjustment: 37 Effective length of query: 637 Effective length of database: 512 Effective search space: 326144 Effective search space used: 326144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory