Align Inositol 2-dehydrogenase 3; EC 1.1.1.18; Myo-inositol 2-dehydrogenase 3; MI 2-dehydrogenase 3 (uncharacterized)
to candidate Ga0059261_3126 Ga0059261_3126 Predicted dehydrogenases and related proteins
Query= curated2:A4FIQ1 (338 letters) >FitnessBrowser__Korea:Ga0059261_3126 Length = 707 Score = 52.4 bits (124), Expect = 4e-11 Identities = 56/183 (30%), Positives = 85/183 (46%), Gaps = 13/183 (7%) Query: 6 GVIGTGMIGQDHIRRLTRVVTGAEIVAVTDIDADRAASVAGGVGARTMPSGADVIGSADV 65 G TGM+ + + T A VT + A R G A T S + + G++D Sbjct: 401 GNYATGMLIPVFKKAGATLDTIASKEGVTGVHAGRKF----GFAATTTDSDSLLAGTSD- 455 Query: 66 DAVLVTSWGPTHAEHVLAAIEAGKAVFCEKPLATEVEDCLRIVEA-ESARGKRLVQVGFM 124 AV++T+ +H V AA++AGK+VF EKPL + + I A +A G + VG+ Sbjct: 456 -AVVITTRHNSHGAMVAAALKAGKSVFVEKPLCLTLAEQAEIETAYAAAGGAARLMVGYN 514 Query: 125 RRYDAGYREMKELVDAGGIGTPLMAHCVHRN--PTVPETYHSAMAAQ---DTAVHEIDTL 179 RR+ ++MK L+ AG G V+ P T +S + A H +D L Sbjct: 515 RRFAPQVQKMKVLL-AGVTGPKAFVMTVNAGAIPAEHWTQNSEIGGGRIIGEACHFVDLL 573 Query: 180 RWL 182 R+L Sbjct: 574 RFL 576 Lambda K H 0.319 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 552 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 707 Length adjustment: 34 Effective length of query: 304 Effective length of database: 673 Effective search space: 204592 Effective search space used: 204592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory