Align BadH (characterized)
to candidate Ga0059261_1451 Ga0059261_1451 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100)
Query= metacyc::MONOMER-893 (255 letters) >FitnessBrowser__Korea:Ga0059261_1451 Length = 240 Score = 160 bits (405), Expect = 2e-44 Identities = 94/252 (37%), Positives = 136/252 (53%), Gaps = 20/252 (7%) Query: 7 KTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAE-----AVR 61 + A++TGG GIG E +A+ D+ + A AG + A E A + Sbjct: 3 RVAIVTGGTRGIG---------EAISVALKDMGMTVAANYAGNDQRAAEFTERTGIKAFK 53 Query: 62 CDIADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHM 121 D+AD + +A LGPVD++VNNAG K W+ ++ NL G +M Sbjct: 54 WDVADYDACQQGVADVEAALGPVDVVVNNAGITRDGTILKMTYQMWKEVMDTNLGGCFNM 113 Query: 122 HHAVLPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVN 181 A PGM ER+ GRIVNI S + G G+ YAA K G+ F+K LA+E AR G+TVN Sbjct: 114 AKATFPGMRERKWGRIVNIGSINGQAGQYGQVNYAAAKSGIHGFTKALAQEGARAGVTVN 173 Query: 182 VVCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFIT 241 + PG DT ++A V P +++E IP+GRLG+ +++A +AF S++ GF+T Sbjct: 174 AIAPGYIDTDMVAAV------PAEVLEKIVAKIPVGRLGQANEIARGVAFLCSEEGGFVT 227 Query: 242 GQVLSVSGGLTM 253 G LS++GG M Sbjct: 228 GSTLSINGGQHM 239 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 240 Length adjustment: 24 Effective length of query: 231 Effective length of database: 216 Effective search space: 49896 Effective search space used: 49896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory