Align BadI (characterized)
to candidate Ga0059261_2668 Ga0059261_2668 Enoyl-CoA hydratase/carnithine racemase
Query= metacyc::MONOMER-892 (260 letters) >FitnessBrowser__Korea:Ga0059261_2668 Length = 256 Score = 108 bits (270), Expect = 1e-28 Identities = 82/260 (31%), Positives = 121/260 (46%), Gaps = 13/260 (5%) Query: 4 EDLIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDRAFC 63 +DL++ + + VA I +NRP K+NA LI ++ V +V+ GAG++AF Sbjct: 3 DDLLFTVADHVATITLNRPAKLNALTPEMAAALIASVSACNSSDAVRCVVITGAGEKAFS 62 Query: 64 TGGDQSTHDGN---YDGRGTVGLPMEELHTAIRDVPKPVIARVQGYAIGGGNVLATICDL 120 G D +T DG +D R ++ A+R KPV+A + GYA+GGG A D+ Sbjct: 63 AGSDITTLDGYATPWDFRNR-----DDYCDALRACRKPVVAAINGYALGGGLETAMAADI 117 Query: 121 TICSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEAMGLANL 180 I S A F K+G + G A L +G A + + ++A A GL + Sbjct: 118 RIASTNARFAAPEIKLGWIGGGGMAAGLTYSMGASNAALMLFTGDMIDAEKALAWGLVSE 177 Query: 181 CVPHDELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYALKLY---YDT 237 V D L A Q+ + R+P A AK N+ AH Y L + T Sbjct: 178 VVAPDALLARAQEIARTIASRAPIAAETAK--LNLRAAHTMPWDKAIEYERDLQAICFAT 235 Query: 238 DESREGVKALQEKRKPEFRK 257 D+++EG A EKR P FR+ Sbjct: 236 DDAKEGRAAFAEKRAPVFRR 255 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 256 Length adjustment: 24 Effective length of query: 236 Effective length of database: 232 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory