Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate Ga0059261_0017 Ga0059261_0017 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit
Query= uniprot:G1UHX5 (328 letters) >FitnessBrowser__Korea:Ga0059261_0017 Length = 467 Score = 207 bits (528), Expect = 3e-58 Identities = 127/327 (38%), Positives = 174/327 (53%), Gaps = 2/327 (0%) Query: 1 MSEITMAKALNTALRDALRDDPRTILFGEDIGALGGVFRITDGLAAEFGDERCFDTPLAE 60 M + T+ +AL A+ + +R D R + GE++ G +++T GL EFG +R DTP+ E Sbjct: 141 MVKTTVREALRDAMAEEMRADGRVFVMGEEVAEYQGAYKVTQGLLDEFGAKRVIDTPITE 200 Query: 61 SAILGTAVGMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYG 120 G G AM G +PV+E FA A + +++ AK + G + P+ R P G Sbjct: 201 YGFAGVGTGAAMGGLKPVIEFMTFNFAMQAIDHIINSAAKTNYMSGGQMRCPIVFRGPNG 260 Query: 121 GGIGGVEHHSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLYWRK 180 HS + +Y + PGL V+ P AADA LL+ +I S DPVVFLE + +Y R Sbjct: 261 AASRVAAQHSQNFGPWYASVPGLIVIAPYDAADAKGLLKAAIRSEDPVVFLENELMYGRS 320 Query: 181 -EALGLPVDTGPLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEVIDLRTLM 239 + L P+G A I R G T+++Y V ALEAAEA A G D EVIDLRTL Sbjct: 321 FDVPKLDDWVLPIGKARIVREGRDVTIVSYSIGVGVALEAAEALAGEGIDAEVIDLRTLR 380 Query: 240 PLDDATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVTGFDVPYP 299 PLD ATV S+++T R VVV E +EI E F L+APV RVT DVP P Sbjct: 381 PLDKATVLESLKKTNRMVVVEEGWPVCSIASEIVTIAMEEGFDDLDAPVIRVTNEDVPLP 440 Query: 300 -PPLLERHYLPGVDRILDAVASLEWEA 325 LE+ L D+++ V + + A Sbjct: 441 YAANLEKLALITADKVVAGVKKVTYRA 467 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 467 Length adjustment: 31 Effective length of query: 297 Effective length of database: 436 Effective search space: 129492 Effective search space used: 129492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory