Align Benzoyl-CoA reductase electron transfer protein, putative (characterized, see rationale)
to candidate Ga0059261_0704 Ga0059261_0704 NADH-quinone oxidoreductase, F subunit
Query= uniprot:Q39TW5 (635 letters) >FitnessBrowser__Korea:Ga0059261_0704 Length = 434 Score = 290 bits (742), Expect = 9e-83 Identities = 156/402 (38%), Positives = 233/402 (57%), Gaps = 5/402 (1%) Query: 164 SKVLFQMTPEDVMGEIKKSNLRGRGGGGFPAWRKWEESRNAPDPIK--YVIVNADEGDPG 221 +K L ++ P+ ++ +IK S LRGRGG GFP KW P P + ++++NADE +PG Sbjct: 32 TKKLLELGPDTIIEKIKASGLRGRGGAGFPTGMKWSFMPKNPTPERPSFLVINADESEPG 91 Query: 222 AFMDRALIEGNPHSILEGLIIGAYAVGAHEGFIYVRQEYPLAVENINLAIRQASERGFVG 281 + DR +I +PH +LEG ++ +A+ A +IY+R EY + + AI +A G +G Sbjct: 92 SCKDREIIRHDPHLLLEGALVAGFAMRARAAYIYIRGEYIREAQTLFAAIEEAYAAGLLG 151 Query: 282 KDILGSGFDFTVKVHMGAGAFVCGESSALMTALEGRAGEPRPKYIHTAVKGVWDHPSVLN 341 K+ GSG+DF V H GAGA++CGE +A++ +LEG+ G+PR K A G++ P+ +N Sbjct: 152 KNACGSGYDFDVFCHRGAGAYICGEETAMIESLEGKKGQPRLKPPFPAGAGLYGCPTTVN 211 Query: 342 NVETWANVTQIITKGADWFTSYGTAGSTGTKIFSLVGKITNTGLVEVPMGVTLRDIITKV 401 NVE+ A I+ + +WF S+G + GTK+F + G + +VE M + R++I K Sbjct: 212 NVESIAVAPTILRRSPEWFASFGNENNRGTKLFQISGHVEKPCVVEEAMSIPFRELIEKH 271 Query: 402 GGGIPGG-KKFKAVQTGGPSGGCIPEA-MLDLPVDFDELTKAGSMMGSGGMIVMDEDTCM 459 GGI GG AV GG S +P A ++D P+DFD L GS +G+ +IVMD+ T + Sbjct: 272 CGGIRGGWDNLLAVIPGGSSVPLVPAAQIMDAPMDFDGLKAVGSGLGTAAVIVMDKSTDI 331 Query: 460 VDIARYFIDFLKDESCGKCTPCREGIRQMLAVLTRITVGKGKEGDIELLEELAEST-GAA 518 V F K ESCG+CTPCREG M V+ R+ G +I+ L + + G Sbjct: 332 VKAISRISYFYKHESCGQCTPCREGTGWMWRVMERLRTGDADISEIDTLFNVTKQVEGHT 391 Query: 519 LCALGKSAPNPVLSTIRYFRDEYEAHIREKKCPALSCKEMIA 560 +CALG +A P+ I++FR E E I EK+ LS + A Sbjct: 392 ICALGDAAAWPIQGLIKHFRPEMERRILEKQGGGLSTMQEAA 433 Lambda K H 0.319 0.138 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 757 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 635 Length of database: 434 Length adjustment: 35 Effective length of query: 600 Effective length of database: 399 Effective search space: 239400 Effective search space used: 239400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory