Align Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 (characterized)
to candidate Ga0059261_1693 Ga0059261_1693 fumarylacetoacetate hydrolase (EC 3.7.1.2)
Query= SwissProt::P16930 (419 letters) >FitnessBrowser__Korea:Ga0059261_1693 Length = 419 Score = 390 bits (1002), Expect = e-113 Identities = 204/412 (49%), Positives = 269/412 (65%), Gaps = 16/412 (3%) Query: 7 AEDSDFPIHNLPYGVFS--TRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQ 64 A D+DFP++NLPYGVFS TRG PR GVAIGD+ILD++ ++ G + +F + Sbjct: 13 AADTDFPLNNLPYGVFSDATRG---PRCGVAIGDRILDMAALEA--AGLLRLGDVPLFAE 67 Query: 65 PTLNSFMGLGQAAWKEARVFLQNLLSVSQA-RLRDDTELRKCAFISQASATMHLPATIGD 123 P N+ M G A W R L LL+ A R+ + L + A A +HLP + Sbjct: 68 PGWNTLMAQGPAVWGALRAQLIALLAEGAAERVAVEPHL-----VPMAGAQLHLPFRVAG 122 Query: 124 YTDFYSSRQHATNVGIMFRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPD 183 YTDFY+SRQHA NVG MFR ENAL PNWLH+P+GY+GRASSVVVSGT +RRP GQ+K Sbjct: 123 YTDFYASRQHAFNVGTMFRGAENALPPNWLHIPIGYNGRASSVVVSGTDVRRPWGQVKGP 182 Query: 184 DSKPPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQKWE 243 + P + D+ELE+ VG G+ +P+ +++A IFG VL+NDWSARDIQ WE Sbjct: 183 EDAAPRFAPSARFDIELELGAIVGTGS--SDPLTVAEADAMIFGYVLLNDWSARDIQAWE 240 Query: 244 YVPLGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQDPRPLPYLCHDEPYTFDINLSVNL 303 Y PLGPF GK+ TT+SPW+V AL PF P ++ LPYL P +DI+L V L Sbjct: 241 YQPLGPFQGKATATTISPWIVTAAALEPFRAHGPAREKPLLPYLDEPGPMLYDIDLEVGL 300 Query: 304 KGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSML 363 EG +++ I +++++ MY++ QQL HHS GC + GDLL +GTISGP+ +FGS+L Sbjct: 301 TPEGGAESV-ISRTSYREMYYSAAQQLAHHSTAGCRMEVGDLLGTGTISGPDKGSFGSLL 359 Query: 364 ELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDGYRIGFGQCAGKVLPA 415 ELSW G +P+ L G R F+ DGD +I+ G C+GDGYRIGFG C+G V+PA Sbjct: 360 ELSWGGKEPLTLAGGAQRSFVEDGDTLILRGQCRGDGYRIGFGDCSGTVIPA 411 Lambda K H 0.321 0.139 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 582 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 419 Length adjustment: 32 Effective length of query: 387 Effective length of database: 387 Effective search space: 149769 Effective search space used: 149769 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate Ga0059261_1693 Ga0059261_1693 (fumarylacetoacetate hydrolase (EC 3.7.1.2))
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.1994194.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-155 502.0 0.0 7.4e-155 501.8 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_1693 Ga0059261_1693 fumarylacetoaceta Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_1693 Ga0059261_1693 fumarylacetoacetate hydrolase (EC 3.7.1.2) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 501.8 0.0 7.4e-155 7.4e-155 1 419 [. 6 411 .. 6 412 .. 0.96 Alignments for each domain: == domain 1 score: 501.8 bits; conditional E-value: 7.4e-155 TIGR01266 1 sfvavak..nsdfplqnlPyGvfstkadssrrigvaiGdqildlskiaaaglfeglalkehqevfkest 67 s+va a+ ++dfpl+nlPyGvfs a+ +r+gvaiGd+ild++++ aagl+ f e lcl|FitnessBrowser__Korea:Ga0059261_1693 6 SWVAAANaaDTDFPLNNLPYGVFS-DATRGPRCGVAIGDRILDMAALEAAGLLRL----GDVPLFAEPG 69 899998866899************.9999********************999886....56789***** PP TIGR01266 68 lnaflalgrparkevrerlqkllsesaevlrdnaalrkeallaqaeatmhlPaqiGdytdfyssirhat 136 n+++a g +++ ++r++l ll+e a+ + + l+++a a+ hlP ++ ytdfy+s++ha lcl|FitnessBrowser__Korea:Ga0059261_1693 70 WNTLMAQGPAVWGALRAQLIALLAEGAAE----RVAVEPHLVPMAGAQLHLPFRVAGYTDFYASRQHAF 134 ************************66555....444556799*************************** PP TIGR01266 137 nvGilfrgkdnallPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgpckkldlelelaf 205 nvG +frg +nal Pn+ h+P+gy GrassvvvsGt++rrP Gq+k ++ P f+p++++d+elel+ lcl|FitnessBrowser__Korea:Ga0059261_1693 135 NVGTMFRGAENALPPNWLHIPIGYNGRASSVVVSGTDVRRPWGQVKGPEDAAPRFAPSARFDIELELGA 203 ********************************************************************* PP TIGR01266 206 fvgtenelGeavpiekaeehifGvvllndwsardiqaweyvPlGPflaksfattvsPwvvsiealePfr 274 vgt+ + +++ + a+ ifG vllndwsardiqawey+PlGPf +k+ att+sPw+v++ alePfr lcl|FitnessBrowser__Korea:Ga0059261_1693 204 IVGTGSS--DPLTVAEADAMIFGYVLLNDWSARDIQAWEYQPLGPFQGKATATTISPWIVTAAALEPFR 270 ****985..9*********************************************************** PP TIGR01266 275 vaqlePeqdpkplpylredradtafdielevslkteGlaeaavisrsnakslywtlkqqlahhsvnGcn 343 + P +++ +lpyl e ++ +di+lev l++eG + ++visr+ +++y++ +qqlahhs +Gc+ lcl|FitnessBrowser__Korea:Ga0059261_1693 271 AH--GPAREKPLLPYLDEP-GPMLYDIDLEVGLTPEG-GAESVISRTSYREMYYSAAQQLAHHSTAGCR 335 *9..9***********999.9****************.8889*************************** PP TIGR01266 344 lraGdllgsGtisGkeeeafGsllelsakGkkevkladgetrkfledGdevilrgvckkeGvrvGfGec 412 ++ Gdllg+GtisG+++++fGsllels++Gk+++ la g +r f+edGd++ilrg+c+ +G+r+GfG+c lcl|FitnessBrowser__Korea:Ga0059261_1693 336 MEVGDLLGTGTISGPDKGSFGSLLELSWGGKEPLTLAGGAQRSFVEDGDTLILRGQCRGDGYRIGFGDC 404 ********************************************************************* PP TIGR01266 413 aGkvlpa 419 G+v+pa lcl|FitnessBrowser__Korea:Ga0059261_1693 405 SGTVIPA 411 *****98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (419 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 16.49 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory