Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate Ga0059261_2542 Ga0059261_2542 ABC-type (unclassified) transport system, ATPase component
Query= CharProtDB::CH_003736 (237 letters) >FitnessBrowser__Korea:Ga0059261_2542 Length = 258 Score = 122 bits (306), Expect = 7e-33 Identities = 74/233 (31%), Positives = 128/233 (54%), Gaps = 3/233 (1%) Query: 6 LSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVFD 65 L+ ++ Y K L +VSL + +GE+V L+G NGAGKTT ++ G + +GRI+ D Sbjct: 22 LAVVSIAKSYDKRVVLSDVSLSVGKGEVVGLLGPNGAGKTTCFYSVMGLVKPDAGRIMLD 81 Query: 66 DKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFFAERDQFQE--RIKWVYEL 123 DIT + + +P+ +F +TV +N++ +E D+ R+ + E Sbjct: 82 GVDITPLPMYRRAILGLGYLPQETSIFRGLTVAKNISAVLELSEPDKSARAARLDQLLEE 141 Query: 124 FPRLHERRIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIEQL 183 F L R A +SGGE++ I RAL ++P ++LLDEP G+ PI I I D +++L Sbjct: 142 FG-LTRLRDAPAMALSGGERRRAEIARALAADPSIMLLDEPFAGIDPISIADIRDLVKEL 200 Query: 184 REQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDTGDALLANEAVRSAYLG 236 + + + + + + N + L + DR ++ +G V+ + + + L+A+ VR YLG Sbjct: 201 KTRNIGVLITDHNVRETLDIVDRASIIYDGRVLFAGSPEDLVADANVRRLYLG 253 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 258 Length adjustment: 24 Effective length of query: 213 Effective length of database: 234 Effective search space: 49842 Effective search space used: 49842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory