Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate Ga0059261_2840 Ga0059261_2840 Enoyl-CoA hydratase/carnithine racemase
Query= metacyc::MONOMER-15953 (257 letters) >FitnessBrowser__Korea:Ga0059261_2840 Length = 263 Score = 143 bits (360), Expect = 4e-39 Identities = 91/259 (35%), Positives = 135/259 (52%), Gaps = 10/259 (3%) Query: 5 LSVDAPEQGVRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGSRKAFAAG 64 L +D + G+ + T+ RP +NA++ L+ A + D E R ++LTG+ +AF AG Sbjct: 4 LQIDRHDGGIVIATINRPARMNAIDRNLIASFEALFDRLDADREARVLILTGAGRAFCAG 63 Query: 65 ADIK----EMA--ERDLVGILEDPRVAHWQRIAAFSKPLIAAVNGFCLGGGCELAMHADI 118 AD+K E A E L L R+ +RIA +P+IAAVNG GGG + ADI Sbjct: 64 ADLKSDFVESAGPEESLASQLRLARL--MERIANLRQPVIAAVNGAAAGGGFAFTLAADI 121 Query: 119 LIAGEDARFGQPEINLGIMPGAGGTQRLL-RAVGKSLAMQMVLSGQAIDARHAQRAGLVS 177 IAG A F LG+ G G LL R +G S A +++L+G+ DA A+R G V Sbjct: 122 RIAGRSAHFSIANARLGLSAGECGISWLLPRLIGLSRAFELMLTGRKFDAEEAERIGYVV 181 Query: 178 EVTLPELTIERALAIARVIAQKAPLAVRLAKEALLK-AEDTDLASGLRFERHAFTVLAGT 236 ++ ++ AL AR+IA AP V + K+ + + E + + + E + G+ Sbjct: 182 RTVADDVLLDTALETARLIAANAPFGVAMTKDVVRRNLETASMQAAIALEARTQLLCGGS 241 Query: 237 ADRAEGIRAFQEKRRPEFT 255 D E + AF EKR P+FT Sbjct: 242 GDFREAVSAFLEKRPPDFT 260 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 263 Length adjustment: 24 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory