Align pimeloyl-CoA dehydrogenase large subunit (EC 1.3.1.62) (characterized)
to candidate Ga0059261_0861 Ga0059261_0861 Acyl-CoA dehydrogenases
Query= metacyc::MONOMER-20676 (396 letters) >FitnessBrowser__Korea:Ga0059261_0861 Length = 403 Score = 259 bits (663), Expect = 7e-74 Identities = 153/395 (38%), Positives = 224/395 (56%), Gaps = 21/395 (5%) Query: 12 FRDEVRQFFKDNVPAKTRQK-----LIEGRHNTKEEMVEWYRILNKKGWAVTHWPKEYGG 66 FR EVR++ N PA + K +EG + W + + +KGW V WP+EYGG Sbjct: 16 FRTEVREWLAANFPASLKGKDNTMSAVEGPTEETPDQAAWRKAMGEKGWGVPTWPREYGG 75 Query: 67 TGWSSVQHYIFNEELQAAPAPQPLA-FGVSMVGPVIYTFGSEEQKKRFLPRIANVDDWWC 125 G S + + +E+ A A P+ GV M GP + +G+E QK+ +P IA + WC Sbjct: 76 GGLSRAEAKVLADEMAKAGAWNPIGGMGVMMFGPTLLEYGNEAQKREHIPAIAKGEVRWC 135 Query: 126 QGFSEPGSGSDLASLKTKAEKKGDKWIINGQKTWTTLAQHADWIFCLCRTDPAAKKQEGI 185 QG+SEP +GSDLA+L+ AE KGD +++NGQKTWT+ Q AD FC+ RTD +KQ GI Sbjct: 136 QGYSEPNAGSDLANLQCFAEDKGDHYLVNGQKTWTSGGQWADKCFCIVRTD-KTQKQGGI 194 Query: 186 SFILVDMKTKGITVRPIQTIDGGHEVNEVFFDDVEVPLENLVGQENKGWDYAKFLLGNER 245 +F+L+DM T G+ V+PIQ I G E FF +V+VP EN VG+E +GW K LL +ER Sbjct: 195 TFLLIDMDTPGVEVKPIQMISGMSPFCETFFTNVKVPKENRVGEEGQGWTIGKRLLQHER 254 Query: 246 T----GIARVGMSKERIRRIKQLAAQVESGGKPVIEDPKFRDKLAAVEIELKALELTQLR 301 T G +R+ S + I + ++ G+ + DP R ++A E++ +A LT +R Sbjct: 255 TNLSGGGSRLMPSGPSLADIAKNYVGADAEGR--VADPDLRARIAKWEMDWRAFLLTAMR 312 Query: 302 VVADEGKHGKGKPNPASSVLKIKGSEIQQATTELLMEVIGPFAAPYDVHGDDDSNETMDW 361 V A+ G + SS+LK G+++ Q ELL+E+ G ++ G+ S + Sbjct: 313 VQAE--SKAAGGVSEVSSILKTVGTKLGQERAELLIEIQGHEGLGWE--GEGFSEAQLKG 368 Query: 362 TAQIAPGYFNNRKVSIYGGSNEIQRNIICKAVLGL 396 T + + +IYGGS EIQ NII K +LG+ Sbjct: 369 TR----AWLFGKATTIYGGSTEIQNNIIAKRILGM 399 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 23 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 403 Length adjustment: 31 Effective length of query: 365 Effective length of database: 372 Effective search space: 135780 Effective search space used: 135780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory