Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate Ga0059261_2542 Ga0059261_2542 ABC-type (unclassified) transport system, ATPase component
Query= uniprot:G8ALJ0 (294 letters) >FitnessBrowser__Korea:Ga0059261_2542 Length = 258 Score = 109 bits (272), Expect = 7e-29 Identities = 80/260 (30%), Positives = 125/260 (48%), Gaps = 29/260 (11%) Query: 12 LTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTLR 71 L V + + V ++DVS S GE+ ++GPNGAGKTT F + G P GR+ L Sbjct: 22 LAVVSIAKSYDKRVVLSDVSLSVGKGEVVGLLGPNGAGKTTCFYSVMGLVKPDAGRIMLD 81 Query: 72 HADGKEFLLERMPGYRISQKASVARTF--QNIRLFGGMSVLENLIVAQHNKLIRASGFSI 129 D + +P YR +A + + Q +F G++V +N I Sbjct: 82 GVD-----ITPLPMYR---RAILGLGYLPQETSIFRGLTVAKN----------------I 117 Query: 130 AGLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPVM 189 + +L L ++ R A L+ L D A L G +RR EIARA+ +P + Sbjct: 118 SAVLELSEPDKSARAA--RLDQLLEEFGLTRLRDAPAMALSGGERRRAEIARALAADPSI 175 Query: 190 LCLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRKIS 249 + LDEP AG++P ++ DL+ ++ + IGVL+ +H++ + I D ++ GR + Sbjct: 176 MLLDEPFAGIDPISIADIRDLVKELKTRN-IGVLITDHNVRETLDIVDRASIIYDGRVLF 234 Query: 250 DGDPAFVKNDPAVIRAYLGE 269 G P + D V R YLGE Sbjct: 235 AGSPEDLVADANVRRLYLGE 254 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 258 Length adjustment: 25 Effective length of query: 269 Effective length of database: 233 Effective search space: 62677 Effective search space used: 62677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory