Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate Ga0059261_0484 Ga0059261_0484 ABC-type multidrug transport system, ATPase component
Query= uniprot:G8ALJ1 (236 letters) >FitnessBrowser__Korea:Ga0059261_0484 Length = 245 Score = 95.5 bits (236), Expect = 8e-25 Identities = 72/227 (31%), Positives = 108/227 (47%), Gaps = 5/227 (2%) Query: 11 YGAIEALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRITFEGQDITQMPT 70 YGA E L+G+ + + AG I +L+G NGAGKST L + G RA+ G I G D P Sbjct: 17 YGAQEVLRGLTLSVPAGSITALLGGNGAGKSTTLAALLGFVRAQSGTILVCGVDPGSDP- 75 Query: 71 YELVRLGIAQSPEGRRIFPRMSVLENLQMGSITAKPGSFANELERVLTLFPRLKERISQR 130 + R IA PE ++ +S EN + + ++ +E QR Sbjct: 76 -DGARRRIAYLPENVALYEHLSATENAEYLLALSGEQHARRDITEAFAAAGLQEEAWDQR 134 Query: 131 AGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQIFQAVKDINREQKMTVFMV 190 G S G +Q +AI AL+ + +LLLDEP+ GL P F A+ R++ V MV Sbjct: 135 LGGFSKGMRQKVAIAVALLRRVPVLLLDEPTSGLDPRATAD-FNALVAQVRDRGTAVLMV 193 Query: 191 EQNAFHALKLAHRGYVMVNGKVT--MSGTGAELLANEEVRSAYLEGG 235 + A +A R + NG+VT ++ +G E + + + GG Sbjct: 194 THDLLSAADVADRIAFLENGRVTDEVAASGPERFDVRALHARFQVGG 240 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 245 Length adjustment: 23 Effective length of query: 213 Effective length of database: 222 Effective search space: 47286 Effective search space used: 47286 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory