Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate Ga0059261_0484 Ga0059261_0484 ABC-type multidrug transport system, ATPase component
Query= uniprot:D8IUY7 (241 letters) >FitnessBrowser__Korea:Ga0059261_0484 Length = 245 Score = 90.9 bits (224), Expect = 2e-23 Identities = 65/212 (30%), Positives = 106/212 (50%), Gaps = 5/212 (2%) Query: 8 VQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHIEYL 67 +Q +S+AYG + ++G+ L V G + L+G NGAGK+TTL A+ G + A G I Sbjct: 10 LQDVSLAYGAQEVLRGLTLSVPAGSITALLGGNGAGKSTTLAALLGFVRAQ--SGTILVC 67 Query: 68 GQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAADIDKWFAVF 127 G + + + ++A +PE ++ +S EN S ++ DI + FA Sbjct: 68 G--VDPGSDPDGARRRIAYLPENVALYEHLSATENAEYLLALSGEQ-HARRDITEAFAAA 124 Query: 128 PRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEVIRNVS 187 +E Q G S G +Q +A+A AL+ +LLLDEP+ GL P ++ V Sbjct: 125 GLQEEAWDQRLGGFSKGMRQKVAIAVALLRRVPVLLLDEPTSGLDPRATADFNALVAQVR 184 Query: 188 AQGITILLVEQNAKLALEAAHRGYVMESGLIT 219 +G +L+V + A + A R +E+G +T Sbjct: 185 DRGTAVLMVTHDLLSAADVADRIAFLENGRVT 216 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 245 Length adjustment: 23 Effective length of query: 218 Effective length of database: 222 Effective search space: 48396 Effective search space used: 48396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory