Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate Ga0059261_1321 Ga0059261_1321 ABC-type antimicrobial peptide transport system, ATPase component
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__Korea:Ga0059261_1321 Length = 238 Score = 106 bits (265), Expect = 4e-28 Identities = 78/246 (31%), Positives = 108/246 (43%), Gaps = 21/246 (8%) Query: 4 IEIRNVYKIFGHDAKKALTMVEDGLDKADILSRSGCTVGLNDVSLKIGAGKIFVIMGLSG 63 I +RN+ K+FG A L V L I +MG SG Sbjct: 8 IRLRNITKVFGEGAT--------------------AFQALKGVDLDIAERDFVAVMGPSG 47 Query: 64 SGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAFRMRRVSMVFQSFALMPHRTVL 123 SGKST + + L PTSGE LF G I L R + + VFQ F L+ L Sbjct: 48 SGKSTTMNILGCLDVPTSGEFLFKGVYIETLDRDQRALVRRKYLGFVFQGFNLLSRTNAL 107 Query: 124 QNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAADTD 183 +NV RG K E+GM ++ VGL+ + P +LSGG QRV +ARA+ Sbjct: 108 ENVELPLLYRGEDKKVRHELGMAALEKVGLADWWDHTPAELSGGQPQRVAIARAIVTSPA 167 Query: 184 VILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAILRDGQVV 243 V+L DE LD ++ + L L ++ T++ +TH+ D A I +DG V Sbjct: 168 VLLADEPTGNLDSARSVEIMELLTSLNKDSGITVLMVTHEPDMA-AFARTIVHFKDGLVE 226 Query: 244 QVGTPN 249 + N Sbjct: 227 RTEAGN 232 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 238 Length adjustment: 24 Effective length of query: 251 Effective length of database: 214 Effective search space: 53714 Effective search space used: 53714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory