Align BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized)
to candidate Ga0059261_1870 Ga0059261_1870 ABC-type transport system involved in resistance to organic solvents, ATPase component
Query= TCDB::Q9RQ06 (407 letters) >FitnessBrowser__Korea:Ga0059261_1870 Length = 273 Score = 125 bits (313), Expect = 2e-33 Identities = 73/210 (34%), Positives = 122/210 (58%), Gaps = 6/210 (2%) Query: 48 NFEINEGEIFVIMGLSGSGKSTLLRLLNRLIEPTSGKIFIDDQDVATLNKEDLLQVRRKS 107 + ++ +GEI ++G SG+GKS L+R + L EP +G I + +DV LN E+ +++R++ Sbjct: 35 DLDVRQGEILGVVGGSGTGKSVLMRSIIGLQEPDAGSIEVFGEDVQHLNTEEAIELRKR- 93 Query: 108 MSMVFQNFGLFPHRTILENTEYGLEVQNVPKEERRKRAEKALDNANLL----DFKDQYPK 163 ++FQ LF T+ EN + L+ + P ++ E A + D +YP Sbjct: 94 WGVLFQGGALFSTLTVAENVQVPLK-EFYPAFDQALLDEIAAYKVVMTGLPSDAGPKYPA 152 Query: 164 QLSGGMQQRVGLARALANDPEILLMDEAFSALDPLIRREMQDELLELQAKFQKTIIFVSH 223 +LSGGM++R GLAR+LA DPE+L +DE + LDP+ + L LQ T+ ++H Sbjct: 153 ELSGGMKKRAGLARSLALDPELLFLDEPTAGLDPIGAAAFDELTLALQRTLGLTVFLITH 212 Query: 224 DLNEALRIGDRIAIMKDGKIMQIGTGEEIL 253 DL+ I DR+A++ D ++ +GT +E+L Sbjct: 213 DLDTLYAICDRVAVLADKHVIAVGTIDELL 242 Lambda K H 0.316 0.135 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 407 Length of database: 273 Length adjustment: 28 Effective length of query: 379 Effective length of database: 245 Effective search space: 92855 Effective search space used: 92855 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory