Align proline porter II (characterized)
to candidate Ga0059261_3322 Ga0059261_3322 Arabinose efflux permease
Query= CharProtDB::CH_024324 (500 letters) >FitnessBrowser__Korea:Ga0059261_3322 Length = 445 Score = 211 bits (537), Expect = 4e-59 Identities = 127/418 (30%), Positives = 208/418 (49%), Gaps = 17/418 (4%) Query: 25 KAITAASLGNAMEWFDFGVYGFVAYALGKVFFPGADPSVQMVAALATFSVPFLIRPLGGL 84 +A A S+GN +EW+DF Y + A FFP D + Q++ A ++ FLIRPLGG Sbjct: 35 RAAVAGSVGNLIEWYDFYAYAYTALYFASAFFPAGDRTAQLLNVAAIYAAGFLIRPLGGW 94 Query: 85 FFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYDTIGIWAPILLLICKMAQGFSVGGE 144 FFG D++GR+ + ++V+M + +G++P+Y TIG AP LLL+ ++ QGFS GG+ Sbjct: 95 FFGRYADRHGRRAAMIASVVLMGAGSLLVGVLPTYATIGAAAPALLLVARLMQGFSTGGQ 154 Query: 145 YTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGAGVVVLISTIVGEANFLDWGWRIPF 204 Y A+ +++E + KRGF S+ I G + VV + + + E +WGWR+PF Sbjct: 155 YGAAATYLSEIAEPGKRGFYASFQFVTLIGGQLFALLVVFALQSTMSETAIREWGWRLPF 214 Query: 205 FIALPLGIIGLYLRHALEETPAFQQHVDKLEQGDREGLQDGPKVSFKEIATKYWRSLLTC 264 + L + + R + ET + +G+ G S K + ++ R++ Sbjct: 215 LLGAVLAGVFILFRDVMHET------AEPASKGEDAG-------SLKAL-FQHPRAMFVV 260 Query: 265 IGLVIATNVTYYMLLTYMPSYLSHNLHYSEDHGVLIIIAIMIGMLFVQPVMGLLSDRFGR 324 + L A VT Y TYM YL + ++ + L +QPV+G LSDR GR Sbjct: 261 MALSAAGAVTLYTFTTYMQKYLVNTAGMDVASASRTMLIVTFAFLLLQPVLGTLSDRIGR 320 Query: 325 RPFVLLGSVALFVLAIPAFILINSNVIGLIFAGLLMLA--VILNCFTGVMASTLPAMFPT 382 R +L+ S + + A+P I + AGLL+ A I++ +T V +FP Sbjct: 321 RTNLLIFSGGMTLFAVPLLGAI-GQAQTMWSAGLLVFAALAIMSFYTSVSGLFKAELFPA 379 Query: 383 HIRYSALAAAFNISVLVAGLTPTLAAWLVESSQNLMMPAYYLMVVAVVGLITGVTMKE 440 +R + I+ + G T AA +++ + + A+Y+ V V + M+E Sbjct: 380 RVRALGVGLGHAIASAIFGGTAEWAALMLKQMGHEGLFAWYVSAVCAVAFVVAWQMRE 437 Lambda K H 0.327 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 562 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 500 Length of database: 445 Length adjustment: 33 Effective length of query: 467 Effective length of database: 412 Effective search space: 192404 Effective search space used: 192404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory