Align 3-hydroxypropionate dehydrogenase (EC 1.1.1.59) (characterized)
to candidate Ga0059261_2257 Ga0059261_2257 Choline dehydrogenase and related flavoproteins
Query= metacyc::MONOMER-15202 (579 letters) >FitnessBrowser__Korea:Ga0059261_2257 Length = 526 Score = 320 bits (821), Expect = 7e-92 Identities = 208/543 (38%), Positives = 274/543 (50%), Gaps = 31/543 (5%) Query: 37 DYIVVGAGTAGCLLANRLSADPANRVLLIEAGGRDNYHWIHIPVGYLYCINNPRTDWRFR 96 D +V+GAG+ G A RLS D V ++EAGGR+ +P + P T+W + Sbjct: 5 DIVVIGAGSGGSAAAGRLSEDGKYSVAVLEAGGRNTGFRTLMPGAI--AMQTPATNWAYE 62 Query: 97 TEPDPGLNGRSLIYPRGKTLGGCSSINGMLYLRGQARDYDGWAELTGDDAWRWDNCLPDF 156 T P PGLNGR PRGK LGG S+IN MLY+RG DYD W E G W W + LP F Sbjct: 63 TVPQPGLNGRRGYQPRGKGLGGSSAINAMLYIRGNPWDYDNW-EALGASGWGWADVLPVF 121 Query: 157 MRHEDHYRLDEGGDADPDHYKFHGHGGEWRIEKQRLKWQVLADFATAAVEAGVPRTRDFN 216 R E + R ++HG G ++ Q F AA +PR DFN Sbjct: 122 KRSETNQR---------GASQWHGGDGPLQVSDQSFVHPGSQAFVDAAASLQIPRNDDFN 172 Query: 217 RGDNEGVDAFEVNQRSGWRWNASKAFLRGVEQRGNLTVWHSTQVLKLDFASGEGSEPRCC 276 EG ++V Q+ G RW A++ +L R NL + T V ++ F G R Sbjct: 173 GVRQEGAGIYQVTQKDGERWTAARGYL---TPRPNLEILCDTVVERVLFEDG-----RAW 224 Query: 277 GVTVERAGKKVVTTARCEVVLSAGAIGSPQLLQLSGIGPTALLAEHAIPVVADLPGVGEN 336 GV R G+ + AR VVL+ G G+ QLL LSGIGP A L EH + V D VG N Sbjct: 225 GVAYSRGGQSKMIRARRAVVLAGGVFGTAQLLMLSGIGPGAHLQEHGLTVRIDRGEVGGN 284 Query: 337 LQDHLQIRSIYKVKGAKTLNTMANSLIGKAKIGL----EYILKRSGPMSMAPSQLCIFTR 392 LQDHL + ++ KG + L SLIG K GL + RSGPM+ ++ F R Sbjct: 285 LQDHLDYVAAFETKGTQFL---GRSLIGSLK-GLGAMARWFRTRSGPMTSPFAEAGAFLR 340 Query: 393 SSKEYEHPNLEYHVQPLSLEAFGQPLHDFPAITASVCNLNPTSRGTVRIKSGNPRQAPAI 452 + E P+++ H +E G+ + C L P SRGTVR+ S +PR AP I Sbjct: 341 TRPELPAPDIQLHFLVAIVEDHGRAKIKTHGYSCHACVLRPESRGTVRLASPDPRAAPLI 400 Query: 453 SPNYLSTEEDRQVAADSLRVTRHIASQPAFAKYDPEEFKPGVQYQSDEDLARLAGDIGTT 512 P +L+ D + +R I + + P + D L RL T Sbjct: 401 DPGFLTDRRDVDLLIKGVRAMYRILDAEPLTAFGGRDRYP-LDRNDDAALERLIRARADT 459 Query: 513 IFHPVGTAKMGRDDDPMAVVDSHLRVRGVTGLRVVDASIMPTITSGNTNSPTLMIAEKAA 572 I+HPVGTA+MG DD AV D LRVRGV GL V DAS+MP + SGNTN+P++MI E+ A Sbjct: 460 IYHPVGTARMGSDD--RAVCDPKLRVRGVDGLYVADASVMPRLISGNTNAPSIMIGERCA 517 Query: 573 GWI 575 +I Sbjct: 518 DFI 520 Lambda K H 0.318 0.135 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 904 Number of extensions: 51 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 579 Length of database: 526 Length adjustment: 36 Effective length of query: 543 Effective length of database: 490 Effective search space: 266070 Effective search space used: 266070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory