Align 3-hydroxypropanonate dehydrogenase (EC 1.1.1.59) (characterized)
to candidate Ga0059261_3686 Ga0059261_3686 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)
Query= metacyc::MONOMER-18957 (354 letters) >FitnessBrowser__Korea:Ga0059261_3686 Length = 295 Score = 121 bits (303), Expect = 3e-32 Identities = 97/322 (30%), Positives = 148/322 (45%), Gaps = 32/322 (9%) Query: 20 GFIGLGLMGQHMARHVYNQLEPSDKLYVYDVDPKHTTQFLTEVTSQTPQNAPLLTPLNSL 79 GFIGLG MG MA N + + +D+ + A P+ S Sbjct: 5 GFIGLGNMGGGMAA---NLAKAGHDVRAFDLSADALER----------AKAAGCLPVESA 51 Query: 80 KDFTTEVDSQLDFIVTMVPEGKHVKSVVSELVGHYKSTGNYDPSIKTTFLDSSTIDIPTS 139 ++ ++TM+P GKHV+ V + V TG +D STID+ T+ Sbjct: 52 AAAAEGAEA----VITMLPAGKHVEQVYEDSVFGAADTG-------AILIDCSTIDVATA 100 Query: 140 RDVHQLVKSSIPEFDFIDTPVSGGVAGARKGTLSFMLSRETHDDIDPSLTALLSKMGINI 199 R V ++ +D PVSGG+A A GTL+FM+ + L+ MG + Sbjct: 101 RRVADAAQAK--GLAAVDAPVSGGIAAAAGGTLTFMVGGDAA--AFERAEVFLAAMGKAV 156 Query: 200 FPCGATHGTGLAAKLANNYLLAITNIAAADSFQLAESFGLNLQNYAKLVAVSTGKSWASV 259 G +G G A+K+ NN LL T +A ++ LA+ GL+ Q + + +VS+G W+ Sbjct: 157 IHAGG-NGAGQASKICNNMLLGATMVATCEALLLAQKLGLDPQTFYDIASVSSGACWSLN 215 Query: 260 DNCPIPGVYPDNNLPSDVNYEGGFITKLTRKDVVLATESAKFNNRFLMLGDIGRHWYDKA 319 P+PG+ P P+D Y+GGF L KD+ LA E+A+ + +G Y K Sbjct: 216 TYAPLPGMGPQT--PADNGYQGGFAAGLMLKDLKLAMEAAESTHSETPMGARAAELYTKF 273 Query: 320 CEREDIANRDLSVLFEWLGDLK 341 + + A D S + + LGD K Sbjct: 274 ADAGN-AGVDFSGIIKMLGDGK 294 Lambda K H 0.317 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 10 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 295 Length adjustment: 28 Effective length of query: 326 Effective length of database: 267 Effective search space: 87042 Effective search space used: 87042 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory