Align 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate Ga0059261_3205 Ga0059261_3205 transaminase, acetylornithine/succinylornithine family
Query= BRENDA::Q0K2K2 (423 letters) >FitnessBrowser__Korea:Ga0059261_3205 Length = 398 Score = 195 bits (496), Expect = 2e-54 Identities = 143/405 (35%), Positives = 190/405 (46%), Gaps = 41/405 (10%) Query: 24 CDFYADRAENATLWDVEGRAYTDFAAGIAVLNTGHRHPRVMQAIAAQLERFTHTAYQIVP 83 C+ R E L G Y DFAAGIAV GH HP+ +AIA Q H + Sbjct: 13 CEVRPVRGEGCYLIGERGERYLDFAAGIAVNALGHGHPQFTKAIAEQAATLMHVSNLYGS 72 Query: 84 YQGYVTLAERINALVPIQGLNKTALFT-TGAEAVENAIKIARAH---TGRPG---VIAFS 136 QG LA+RI T FT +G EA+E AIK AR + G P +I F Sbjct: 73 PQGEA-LAQRIVD----NSFADTVFFTNSGVEAIECAIKTARRYHYVNGNPQRHKLITFK 127 Query: 137 GAFHGRTLLGMALTGKVAPYKIGFGPFPSDIYHAPFPSALHGVSTERALQALEGLFKTDI 196 AFHGR++ ++ T + + GF P + F LEG Sbjct: 128 NAFHGRSIGAISATDQ-PKMRDGFEPLLPGFDYVKFND-------------LEGAIAKID 173 Query: 197 DPARVAAIIVEPVQGEGGFQAAPADFMRGLRAVCDQHGIVLIADEVQTGFGRTGKMFAMS 256 D A +VE VQGEGG A +F++GLR CD+HG++LI DE+Q G+GRTGKM+A Sbjct: 174 D--ETAGFLVETVQGEGGMTAGTVEFIQGLRKACDEHGLLLILDEIQCGYGRTGKMWAYE 231 Query: 257 HHDVEPDLITMAKSLAGGMPLSAVSGRAAIMDAPLPGGLGGTYAGNPLAVAAAHAVIDVI 316 H+ + PD++T AK + G PL A G G TY GNPLA+AA AV+DV+ Sbjct: 232 HYGITPDILTAAKGIGNGFPLGACLATEEAAKGMTFGTHGSTYGGNPLAMAAGQAVLDVM 291 Query: 317 EEEKLCERSASLGQQLR---EHLLAQRKHCPAMAEVRGLGSMVAAEFCDPATGQPSAEHA 373 E E +G++LR E L+ H E+RG G M+ + +PA + H Sbjct: 292 LEPGFFEHVEKMGERLRAGFEQLIPNHDH--LFDEIRGKGLMLGIKLKEPAVSRDFVAH- 348 Query: 374 KRVQTRALEAGLVLLTCGTYGNVIRFLYPLTIPQAQFDAALAVLT 418 L LLT NV R L PL I ++ + L+ Sbjct: 349 -------LRENHGLLTVAAGENVFRVLPPLVIEESHIAECIEKLS 386 Lambda K H 0.321 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 456 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 398 Length adjustment: 31 Effective length of query: 392 Effective length of database: 367 Effective search space: 143864 Effective search space used: 143864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory