Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19); betaine-aldehyde dehydrogenase (EC 1.2.1.8) (characterized)
to candidate Ga0059261_1680 Ga0059261_1680 NAD-dependent aldehyde dehydrogenases
Query= BRENDA::Q9S795 (501 letters) >FitnessBrowser__Korea:Ga0059261_1680 Length = 469 Score = 294 bits (752), Expect = 5e-84 Identities = 171/478 (35%), Positives = 257/478 (53%), Gaps = 19/478 (3%) Query: 9 QLFIDGEWREPI-LKKRIPIVNPATEEVIGDIPAATTEDVDVAVNAARRALSRNKGKDWA 67 +L +DG+ P+ + + P+++PAT D P A+T D+D AV AARRA WA Sbjct: 5 RLIVDGK---PLAMAETFPVIDPATGRPFADAPLASTADLDAAVAAARRAFP-----GWA 56 Query: 68 KAPGAVRAKYLRAIAAKVNERKTDLAKLEALDCGKPLDEAVWDMDDVAGCFEFYADLAEG 127 P RA + AIA + K +LA+L + + GKP+ AV ++ A L Sbjct: 57 ATPIEDRAAAILAIADSIEAAKDELARLLSAEQGKPVPNAVGEIMGALAWARATAGLRPA 116 Query: 128 LDAKQKAPVSLPMESFKSYVLKQPLGVVGLITPWNYPLLMAVWKVAPSLAAGCTAILKPS 187 +D + +S + V ++PLGVV I+PWN+P+++A+W + P L AG T ++KPS Sbjct: 117 VDVLKDD------DSVRVEVHRKPLGVVASISPWNFPVMIAIWHIIPGLVAGNTVVMKPS 170 Query: 188 ELASVTCLELADICREVGLPPGVLNVLTGFGSEAGAPLASHPGVDKIAFTGSFATGSKVM 247 + L + +I LPPGVLN +TG E G +ASHPG+DKI FTGS TG +M Sbjct: 171 SFTPLAALRMVEIAN-AHLPPGVLNSVTG-EVEIGRAIASHPGIDKIVFTGSTPTGRSIM 228 Query: 248 TAAAQLVKPVSMELGGKSPLIVFDDVDLDKAAEWALFGCFWTNGQICSATSRLLVHESIA 307 A +K +++ELGG IV D D+DK A F +GQIC+A R+ VHESI Sbjct: 229 ADGAANLKRLTLELGGNDAAIVLPDADVDKVAAKIFAKAFGNSGQICAAVKRVYVHESIH 288 Query: 308 SEFIEKLVKWSKNIKISDPMEEGCRLGPVVSKGQYEKILKFISTAKSEGATILHGGSRPE 367 EKL + ++ + + + GPV ++ Q++ + A++ G L GG E Sbjct: 289 DALAEKLAEMARTAVVGPGSDAASQFGPVQNRKQFDLVRALADDARAHGGRFLAGGEARE 348 Query: 368 HLEKGFFIEPTIITDVTTSMQIWREEVFGPVLCVKTFASEDEAIELANDSHYGLGAAVIS 427 G+F +++ DVT M+I EE FGP+L V ++ ++A+ AN + GLG +V S Sbjct: 349 --GDGYFFPLSVVVDVTDGMRIVDEEQFGPILPVIRYSDPEDALARANANENGLGGSVWS 406 Query: 428 NDTERCDRISEAFEAGIVWINCSQPCFTQAPWGGVKRSGFGRELGEWGLDNYLSVKQV 485 D ++ EAG VW+N P+GG K+SG G E G +GL+ Y+ ++ V Sbjct: 407 ADPAAALAFAQRLEAGTVWVNDHASISPDVPFGGAKQSGVGTEFGLYGLEEYMQLQTV 464 Lambda K H 0.318 0.135 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 573 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 501 Length of database: 469 Length adjustment: 34 Effective length of query: 467 Effective length of database: 435 Effective search space: 203145 Effective search space used: 203145 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory