Align spermidine/putrescine ABC transporter, permease protein PotC (characterized)
to candidate Ga0059261_3667 Ga0059261_3667 molybdate ABC transporter, permease protein
Query= CharProtDB::CH_088340 (264 letters) >FitnessBrowser__Korea:Ga0059261_3667 Length = 229 Score = 75.1 bits (183), Expect = 1e-18 Identities = 67/208 (32%), Positives = 102/208 (49%), Gaps = 22/208 (10%) Query: 71 ATFATL-IGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISLLVLFMLLGIQLGFW 129 AT TL I A L R RF GK + G++ + ++ P +V LL+ F G +G W Sbjct: 20 ATVVTLPIAFALAWLLARTRFPGKILIDGLVHLPLVVPPVVTGWLLLLAFAPAG-PVGGW 78 Query: 130 -------SLLFSHI-------TFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRK 175 S++F LP +V + ++ D R+ AA+ LGAS + R Sbjct: 79 LENWFGISVMFRWTGAAIAAGVMALPLMVRAMRLSIEAVDRRLENAARTLGASRERVFRT 138 Query: 176 IILPLAMPAVAAGWVLSFTLSMDD----VVVSSFVTGPSYEILPLKIYSMVKV-GVSPEV 230 I LPLA+P V A VL F ++ + + S V G + + LPL IY+ ++ +V Sbjct: 139 ITLPLALPGVLAAAVLGFARALGEFGATITFVSNVPGET-QTLPLAIYAALQTPDGEAQV 197 Query: 231 NALATILLVLSLVMVIASQLIARDKTKG 258 LA I + LSL ++AS+L+AR +G Sbjct: 198 LRLALISVALSLAALVASELLARRAGRG 225 Lambda K H 0.329 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 229 Length adjustment: 24 Effective length of query: 240 Effective length of database: 205 Effective search space: 49200 Effective search space used: 49200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory