Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate Ga0059261_0844 Ga0059261_0844 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= metacyc::MONOMER-16230 (256 letters) >FitnessBrowser__Korea:Ga0059261_0844 Length = 254 Score = 153 bits (387), Expect = 3e-42 Identities = 95/252 (37%), Positives = 141/252 (55%), Gaps = 4/252 (1%) Query: 3 LIDKTVIVTGASRGIGRAAARECARQGARVVIGHSGSDEGRAGALSLAEEIAAFGGTAIA 62 L K IVTG+SRGIG+A+A A GA+VVI D A ++ + A GTAIA Sbjct: 6 LTGKVAIVTGSSRGIGKASAEALADHGAKVVISSRKQDACDEVAAAINAKHGA--GTAIA 63 Query: 63 VGADAADLDSGEKLVAAAVEAFGSVDVLVNNAGICPFHSFL-DMPRELYLKTVGTNLNGA 121 V A +D + + LV AFG +D+LV NA P++ L + + + K + N+ Sbjct: 64 VAASISDKAALQNLVDETRRAFGRIDILVCNAASNPYYGPLAGIEDDQFRKILDNNIISN 123 Query: 122 YFTVQAAARRMKEQGRGGAIIAVSSISALVGGAMQTHYTPTKAGLLSLMQSCAIALGPYG 181 ++ +Q A M+E+ + GAI+ VSSI L G + Y +KA L ++ A+ GP Sbjct: 124 HWLIQMTAPEMRER-KDGAIVIVSSIGGLRGSPVIGAYNVSKAADFQLARNYAVEYGPDN 182 Query: 182 IRCNAVLPGTIATDINKEDLSDLEKRERMTSRVPLGRLGEPDDLAGPIVFLASDMARYVT 241 +R N + PG I TD + D +R+ PL RLGEP+D+AG +V+LAS RY+T Sbjct: 183 VRVNCIAPGLIRTDFARALWEDPAAEKRVNQGTPLRRLGEPEDIAGAVVYLASPAGRYMT 242 Query: 242 GASLLVDGGLFV 253 G +++VDGG+ + Sbjct: 243 GQAMVVDGGVTI 254 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 254 Length adjustment: 24 Effective length of query: 232 Effective length of database: 230 Effective search space: 53360 Effective search space used: 53360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory