Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate Ga0059261_3382 Ga0059261_3382 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= metacyc::MONOMER-16231 (254 letters) >FitnessBrowser__Korea:Ga0059261_3382 Length = 245 Score = 155 bits (392), Expect = 7e-43 Identities = 104/246 (42%), Positives = 135/246 (54%), Gaps = 7/246 (2%) Query: 4 LEGKTVLVTGASTGIGRAAAIGAAQHGADVAINYAHSDGPAQSCVAEIEALGQRAIAVKG 63 L+GK LVTG S GIG A A A+ GADVAI YA S G A AEIEALG+RA+A+ Sbjct: 3 LDGKRALVTGGSRGIGAAIARRLAREGADVAITYASSAGAAAGVAAEIEALGRRALAITA 62 Query: 64 DVADPQTAQDFVAKAVETFGKVDVMVSNAGICPFHAFLDMPVDVVERTFKVNLHGAYFMV 123 D D + V +A G +D++V+NAGI D+ ++ + T VNL + V Sbjct: 63 DNRDAAAVEAAVDQAAAALGGIDILVNNAGIFLAAPADDLSLEDFDATMAVNLRAPFVAV 122 Query: 124 QAAAQQMVRQGHGGSIVAVSSISALVGGEYQ-THYTPTKAGVHSLMQSTAIALGKHGIRC 182 +A M G GG IVA+ S ALV + Y+ +KA V L Q+ A L GI Sbjct: 123 RAVLPHM---GEGGRIVAIGSNVALVAPTPGFSVYSTSKAAVTMLHQALARDLAPRGITV 179 Query: 183 NSVLPGTILTEINKDDLADQEKREYMEARTPLGRLGAPEDLAGPIVFLASDMAAYVTGAA 242 N+V PG+ T++N AD ART LGR G+ +D+A + +LAS A VTG A Sbjct: 180 NTVHPGSTDTDMNP---ADGPHAADQIARTALGRFGSADDIASAVAYLASPEARSVTGTA 236 Query: 243 LLVDGG 248 LLVD G Sbjct: 237 LLVDSG 242 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 245 Length adjustment: 24 Effective length of query: 230 Effective length of database: 221 Effective search space: 50830 Effective search space used: 50830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory