Align polyol transporter 5 (characterized)
to candidate Ga0059261_1777 Ga0059261_1777 MFS transporter, sugar porter (SP) family
Query= CharProtDB::CH_091483 (539 letters) >FitnessBrowser__Korea:Ga0059261_1777 Length = 458 Score = 218 bits (556), Expect = 3e-61 Identities = 146/459 (31%), Positives = 236/459 (51%), Gaps = 41/459 (8%) Query: 43 ASMTSILLGYDIGVMSGAMIYIKRDLKINDLQIGILAGSLNIYSLIGSCAAGRTSDWIGR 102 A++ +L G+D V+SGA ++ + D +G S I +++GS AG +D GR Sbjct: 29 AALGGLLFGFDTAVISGATQALQLQFGLTDAMLGFTVASALIGTVLGSLIAGAPADRFGR 88 Query: 103 RYTIVLAGAIFFAGAILMGLSPNY-AFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRG 161 + ++ + ++ GL+P+ AFL+F RF+ G+ +G A ++ P+Y AEVSPA RG Sbjct: 89 KGVMLTVAIAYVVSSLGTGLAPDLNAFLVF-RFMGGLAIGAASVVTPIYIAEVSPARFRG 147 Query: 162 FLNSFPEVFINAGIMLGYVSNLAFSNL-PLKVGWRLMLGIGAVPSVILAIGVLAMPESPR 220 L + ++ I GI++ ++SN + L V WR M GI AVPS I + L +PESPR Sbjct: 148 RLVAMNQLNIVLGILIAFLSNYIIAGLVQYDVAWRWMFGIVAVPSTIFLLVTLLLPESPR 207 Query: 221 WLVMQGRLGDAKRVLDKTSDSPTEATLR----LEDIKHAAGIPADCHDDVVQVSRRNSHG 276 WL + G+ A+ V+ + + A L E + AAG P ++ +R+ Sbjct: 208 WLAIHGQADRARDVMQRLGFADPRAELARIELAEAREEAAGKP--------RLFQRSHF- 258 Query: 277 EGVWRELLIRPTPAVRRVMIAAIGIHFFQQASGIDAVVLFSPRIFKTAGLKTDHQQLLAT 336 TP + AI I F Q SGI+A++ ++PRIF+ AG D LL + Sbjct: 259 -----------TP-----VACAIAIAMFNQLSGINALLYYAPRIFELAGAGAD-SALLQS 301 Query: 337 VAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEKKVMWAVV 396 +AVG F + A FL+DR GRRPLL +L +G L +++ Sbjct: 302 IAVGGTNLVFTVAALFLIDRFGRRPLLFVGSVICAATLLLVGWQLESAKPDGTLILFG-- 359 Query: 397 VAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISISFLPMS 456 ++ ++A F++ G + WV+ SE+FP +R +G ++G + V + I+ +F P+ Sbjct: 360 -----LLGFIAAFAMSQGAVIWVFISEVFPSAVRGKGQALGSTTHWVMAAAITWAF-PVF 413 Query: 457 KAMTTGGAFYLFGGIATVAWVFFYTFLPETQGRMLEDMD 495 A G F FG + + ++ + F+PET G LEDM+ Sbjct: 414 AASVGGWVFAFFGAMMLLQLLWTWKFMPETNGIALEDMN 452 Lambda K H 0.322 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 698 Number of extensions: 32 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 539 Length of database: 458 Length adjustment: 34 Effective length of query: 505 Effective length of database: 424 Effective search space: 214120 Effective search space used: 214120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory