Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate Ga0059261_2843 Ga0059261_2843 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__Korea:Ga0059261_2843 Length = 263 Score = 124 bits (311), Expect = 2e-33 Identities = 86/268 (32%), Positives = 129/268 (48%), Gaps = 29/268 (10%) Query: 5 LNLKEKIITVTGGASGIGLAIVDELLAQGANVQM--IDIHGGDKHQSS-----GNYNFWP 57 + L+ K+ VT GA+GIG L GA++ + ID H G + ++ F P Sbjct: 1 VQLQGKVAVVTAGANGIGEGAALALAGMGADIVLGDIDAHNGARVAAAIEAIGRRAAFRP 60 Query: 58 TDISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVN 117 D+ A + VD FGRID LVNNAG PR +D+ NE ++++ + Sbjct: 61 ADMMQADQARALVDFAAAEFGRIDILVNNAGGVRPRAFLDQ---------NEGNWQRVTD 111 Query: 118 INQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKE 177 +N + +Q+ AR M G IVNV+S L + G S YAA KAA+ FT++ + E Sbjct: 112 LNFTSMLAATQSAARVMAN--GGAIVNVASTEALRAAPGFSVYAACKAAMVEFTKTMALE 169 Query: 178 LGKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTE 237 L IRV +AP +++ GLR ++ + R +PLGR + E Sbjct: 170 LAPRAIRVNCIAPDLIDTPGLRP-----------HMPTDPARIAARDRHVPLGRMATIHE 218 Query: 238 VADFVCYLLSERASYMTGVTTNIAGGKT 265 + +L S AS++TG T + GG T Sbjct: 219 AGSVIAFLASPAASWVTGATIPVDGGIT 246 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 263 Length adjustment: 25 Effective length of query: 242 Effective length of database: 238 Effective search space: 57596 Effective search space used: 57596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory