Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate Ga0059261_2703 Ga0059261_2703 ABC-type multidrug transport system, ATPase component
Query= SwissProt::Q9F9B0 (260 letters) >FitnessBrowser__Korea:Ga0059261_2703 Length = 313 Score = 100 bits (248), Expect = 5e-26 Identities = 76/230 (33%), Positives = 111/230 (48%), Gaps = 17/230 (7%) Query: 4 EPILTARGLVKRYGRV-TALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGE 62 +PIL+ RG+ K Y AL D D+ GEI A++G NGAGK+++I I G VTP G Sbjct: 2 QPILSVRGVSKTYASGHKALGSVDLDINKGEIFALLGPNGAGKTTLISIICGIVTPSSGT 61 Query: 63 IRLEGKPIQFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSLD 122 I ++G P AR I V Q L++ ++ R R Sbjct: 62 IVVDGHDA-ISEPRAARMK-IGLVPQELSVDMFETVQATTRYSR------------RLFG 107 Query: 123 RAAMEKQARAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAAL 182 R A + L +L L +N V LSGG ++ V +A+A A ++ +DEPTA + Sbjct: 108 RPANDAYIDQVLKDLSLYDKRN--SKVMELSGGMKRRVLIAKALAHEPDILFLDEPTAGV 165 Query: 183 GVKESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLGRRLCV 232 V R + +LI +R RG I+L +H + E+ADR+ + G L V Sbjct: 166 DVSLRRDMWKLIGSLRERGTTIILTTHYIEEAEEMADRVGVINKGELLLV 215 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 313 Length adjustment: 26 Effective length of query: 234 Effective length of database: 287 Effective search space: 67158 Effective search space used: 67158 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory