GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fruP in Sphingomonas koreensis DSMZ 15582

Align MFS transporter, FHS family, L-fucose permease (characterized, see rationale)
to candidate Ga0059261_0767 Ga0059261_0767 glucose/galactose transporter

Query= uniprot:A0A1I2JXG1
         (442 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_0767 Ga0059261_0767
           glucose/galactose transporter
          Length = 434

 Score =  337 bits (863), Expect = 6e-97
 Identities = 197/430 (45%), Positives = 267/430 (62%), Gaps = 7/430 (1%)

Query: 4   AAPPAPSKTSLPGAARERYTDYPMAMGVLTSIFFMWGFLTCLNDILIPHLKAVFKLNYAE 63
           AAP     ++ P +   +  + P     + ++FF++G +T LND++IP LK +F LNY +
Sbjct: 2   AAPVTQLSSTDPASGDAQGINAPDLQVFVFALFFIFGGITSLNDVIIPKLKELFTLNYTQ 61

Query: 64  AMLVQFTFFGAYFLMSLPAGLLVARLGYKKGIVAGLAVAGVGAAGFWPAAAMHFYPAFLG 123
           AMLVQF FF AY ++ +P   LV +LGY +G VAGL    VG   F PA+    Y  FL 
Sbjct: 62  AMLVQFCFFTAYLVIGIPGAKLVKKLGYMRGAVAGLLTMMVGCLLFIPASQYATYGVFLF 121

Query: 124 ALFVLATGITVLQVAANAYVALLGPEKSASSRLTLAQALNSLGTFLAPKFGGLLIL-SAA 182
           ALFVLA+G+ ++QV AN  ++LLG  ++A SRLT AQA NSLGT + P  G +LIL S A
Sbjct: 122 ALFVLASGVVIVQVVANPLISLLGKPETAHSRLTFAQAFNSLGTTVFPIVGSILILGSLA 181

Query: 183 VLSAEQIAKLSPAEQVAYRVQEAQTVQGPYLGLAIVLFLLAVFVYLFRLPALTEKTEQAS 242
            ++A+Q++   PA + AYRV E++ +   YLG+A  L ++A  V+LFR   L  +  QAS
Sbjct: 182 TVTADQLS--GPALE-AYRVAESKAIMHGYLGIAAALAVVAGVVWLFR-NRLKGERHQAS 237

Query: 243 VKQHSLVSPLRHPHVLFGVLAIFFYVGGEVAIGSFLVNYLSMPDIGNMSEQAAANWVAYY 302
                L   L  P   FG L IF YVG EV+IGS +VNYL  P +  + EQAA   + +Y
Sbjct: 238 AGLAGL-DLLGRPRFGFGALCIFLYVGAEVSIGSLIVNYLMQPGVMGLQEQAAGKLIGFY 296

Query: 303 WLGAMIGRFIGSALLAKLSPRKLLAIFAAINMALVLTTMMTKGTVAMYSVVSIGLFNSIM 362
           W GAM+GRFIGS L+  +SP KLLA  A   +AL+L +  T G VA YS+++IGL NSIM
Sbjct: 297 WGGAMVGRFIGSGLMRVISPGKLLAFVAVGAVALILISTNTTGHVAGYSLLAIGLMNSIM 356

Query: 363 FPTIFSLGIERMGPMTGEASSLLIMAIVGGAIVPFVQGLFADHIG-VQHAFFLPLLCYAY 421
           FPTIFSL  E++G    + S ++ +AI GGA+VP   G  AD  G +  A  LP +CYA 
Sbjct: 357 FPTIFSLASEKLGGRAADGSGIINIAIFGGAVVPLATGALADATGSLGLALILPAICYAI 416

Query: 422 IVFYGLYGSR 431
           I  +G Y  R
Sbjct: 417 IAGFGYYARR 426


Lambda     K      H
   0.327    0.140    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 515
Number of extensions: 21
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 442
Length of database: 434
Length adjustment: 32
Effective length of query: 410
Effective length of database: 402
Effective search space:   164820
Effective search space used:   164820
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory