Align D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2; D-2HG--pyruvate transhydrogenase DLD2; Actin-interacting protein 2; D-lactate dehydrogenase [cytochrome] 2, mitochondrial; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 (characterized)
to candidate Ga0059261_1691 Ga0059261_1691 FAD/FMN-containing dehydrogenases
Query= SwissProt::P46681 (530 letters) >FitnessBrowser__Korea:Ga0059261_1691 Length = 484 Score = 228 bits (580), Expect = 5e-64 Identities = 138/441 (31%), Positives = 229/441 (51%), Gaps = 14/441 (3%) Query: 93 DWMRKYKGQSKLVLRPKSVEKVSLILNYCNDEKIAVVPQGGNTGLVGG-SVPI-FDELIL 150 D + ++ V RP+S +V+ ++ + IA+VPQGGNTGLVGG +VP L+L Sbjct: 45 DMTGNWPSGAQAVARPRSTAEVARLVQAAAAQGIAIVPQGGNTGLVGGCAVPAETPALLL 104 Query: 151 SLANLNKIRDFDPVSGILKCDAGVILENANNYVMEQNYMFPLDLGAKGSCHVGGVVATNA 210 S L IR D + + +AG IL V + PL LG++GS +GG+V+TNA Sbjct: 105 STRRLRSIRAIDLHAPAVIAEAGCILAEVQEAVAAHGFTIPLGLGSEGSATIGGLVSTNA 164 Query: 211 GGLRLLRYGSLHGSVLGLEVVMPNGQIVNSMHSMRKDNTGYDLKQLFIGSEGTIGIITGV 270 GG+R LR+G + VLGLEVV+P+G++ N + ++ K+N GYDLKQLFIG EGT+G++T Sbjct: 165 GGIRALRHGVMRNQVLGLEVVLPDGRVWNGLRTLAKNNMGYDLKQLFIGGEGTLGVVTAA 224 Query: 271 SILTVPKPKAFNVSYLSVESFEDVQKVFVRARQELSEILSAFEFMDAKSQVLAKSQLKDA 330 ++ VP + +L+VE + R L +++++FE + + + + Sbjct: 225 ALRLVPASRQIETLWLAVEDPAAALALLGALRTALGDLVTSFELIQRRGVEWGMAAVPGL 284 Query: 331 AFPLEDEHPFYILIETSGSNKDHD-DSKLETFLENVMEEGIVTDGVVAQDETELQNLWKW 389 P H +++L E + + + +E L +V E+G+ DG++A+ E + + LW+ Sbjct: 285 RVPDSGAHGWFVLAEVATAATGLPLRAAVEAALADVFEQGLALDGMLAESEAQRRELWRI 344 Query: 390 REMIPEASQANGGVYKYDVSLPLKDLYSLVEATNARLSEAELVGDSPKPVVGAIGYGHVG 449 RE + A DV++PL + A L E E P +G+GH+G Sbjct: 345 REAVVVGKAAGKPSISVDVAVPLGQV-------PAFLVETEAAAAGLLPGCETLGFGHLG 397 Query: 450 DGNLHLNV----AVREYNKNIEKTLEPFVYEFVSSKHGSVSAEHGLGFQKKNYIGYSKSP 505 DGN+H +V E + + V G++ AEHG+G + + + + Sbjct: 398 DGNIHFSVHRGANDTERFAGTAEAIAAKVEAIALRLGGTICAEHGVGRRMRAAVADALDA 457 Query: 506 EEVKMMKDLKVHYDPNGILNP 526 E+ +++ +K DP+ +NP Sbjct: 458 AELDLIRAVKRALDPHNRMNP 478 Lambda K H 0.316 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 530 Length of database: 484 Length adjustment: 34 Effective length of query: 496 Effective length of database: 450 Effective search space: 223200 Effective search space used: 223200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory