Align Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 2.1.2.- (characterized)
to candidate Ga0059261_3309 Ga0059261_3309 formate-dependent phosphoribosylglycinamide formyltransferase (EC 6.3.4.-)
Query= SwissProt::P33221 (392 letters) >FitnessBrowser__Korea:Ga0059261_3309 Length = 388 Score = 401 bits (1030), Expect = e-116 Identities = 212/380 (55%), Positives = 263/380 (69%), Gaps = 3/380 (0%) Query: 14 RVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVEL 73 +++LLGSGELG+E I +RLG +VIA D YA+APAM VA V +MLDG+ALR + Sbjct: 6 KILLLGSGELGREFVISAKRLGAQVIACDSYANAPAMQVADGHEVFSMLDGEALRAAIAK 65 Query: 74 EKPHYIVPEIEAIATDMLIQLEEEGLNVVPCARATKLTMNREGIRRLAAEELQLPTSTYR 133 P Y+VPE+EAI T++L +E EG+ VVP ARA ++TMNR+GIR +AA EL L TS YR Sbjct: 66 HAPDYVVPEVEAIRTEVLADVEAEGVTVVPSARAAQMTMNRDGIREVAAVELGLRTSRYR 125 Query: 134 FADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWKYAQQGGRAGAGRVI 193 +A+S G PC++KPVMSSSGKGQ+ +R A L AW YA R RVI Sbjct: 126 YAESLEEVLAGAEHTGLPCVIKPVMSSSGKGQSTVREASALEAAWDYAVANMRGDRARVI 185 Query: 194 VEGVVKFDFEITLLTVSAVDGVHFCAPVGHRQEDGDYRESWQPQQMSPLALERAQEIARK 253 VE V FD+EITLLTV + GV FC P+GHRQE GDY+ESWQP MS A+ AQ++ARK Sbjct: 186 VEEFVDFDYEITLLTVRSRAGVSFCPPIGHRQERGDYQESWQPAAMSAQAIADAQDMARK 245 Query: 254 VVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDLSEFALHVRAFLGLPVG 313 VV LGGYG+FGVE FV G+EVIFSE+SPRPHDTGMVTLISQ+LSEF LH RA LGLPV Sbjct: 246 VVDDLGGYGIFGVEFFVKGEEVIFSELSPRPHDTGMVTLISQNLSEFDLHARAVLGLPVP 305 Query: 314 GIRQYGPAASAVILPQLTSQNVTFDNVQNAV---GADLQIRLFGKPEIDGSRRLGVALAT 370 +R YGP+ASAVIL + ++ V A+ G ++ +R+F KP RR+GVALA Sbjct: 306 EVRLYGPSASAVILADRDGEAPGYEGVAEALAVPGGEIDLRIFAKPTTRPYRRMGVALAL 365 Query: 371 AESVVDAIERAKHAAGQVKV 390 A A A AAG+V++ Sbjct: 366 AGDTGAARTLAAEAAGKVRI 385 Lambda K H 0.320 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 388 Length adjustment: 31 Effective length of query: 361 Effective length of database: 357 Effective search space: 128877 Effective search space used: 128877 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory