GapMind for catabolism of small carbon sources

 

Alignments for a candidate for epi in Sphingomonas koreensis DSMZ 15582

Align Ethylmalonyl-CoA/methylmalonyl-CoA epimerase; EC 5.1.99.-; EC 5.1.99.1 (characterized)
to candidate Ga0059261_3985 Ga0059261_3985 methylmalonyl-CoA epimerase (EC 5.1.99.1)

Query= SwissProt::Q3IZP4
         (134 letters)



>FitnessBrowser__Korea:Ga0059261_3985
          Length = 141

 Score =  150 bits (379), Expect = 7e-42
 Identities = 72/131 (54%), Positives = 93/131 (70%), Gaps = 3/131 (2%)

Query: 2   IGRLNHVAIAVPDLEAAAAQYRNTLGAE-VGAPQDEPDHGVTVIFITLPNTKIELLHPLG 60
           +GRLNH+ +A P +EA+ A YR+ +GA+ + AP D P  GV V F+  PNT+IEL+ PLG
Sbjct: 4   LGRLNHIGVATPSIEASVAFYRDVMGAQTIHAPFDLPAQGVKVCFVDTPNTQIELIEPLG 63

Query: 61  EGSPIAGFLEKNPAGGIHHICYEVEDILAARDRLKEAGARVLGSGEPKIGAHGKPVLFLH 120
             SPI GFL +NPAGG HH+CYEV DI  A+   +  GA+VL  GEP+IGAHG P+ F+H
Sbjct: 64  ADSPIHGFLARNPAGGQHHVCYEVPDIHEAKAWFEAKGAKVL--GEPRIGAHGTPIFFVH 121

Query: 121 PKDFNGCLVEL 131
           PKD  G L E+
Sbjct: 122 PKDMGGVLTEI 132


Lambda     K      H
   0.319    0.141    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 107
Number of extensions: 9
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 134
Length of database: 141
Length adjustment: 15
Effective length of query: 119
Effective length of database: 126
Effective search space:    14994
Effective search space used:    14994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 42 (20.8 bits)

Align candidate Ga0059261_3985 Ga0059261_3985 (methylmalonyl-CoA epimerase (EC 5.1.99.1))
to HMM TIGR03081 (mce: methylmalonyl-CoA epimerase (EC 5.1.99.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03081.hmm
# target sequence database:        /tmp/gapView.10499.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03081  [M=129]
Accession:   TIGR03081
Description: metmalonyl_epim: methylmalonyl-CoA epimerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    5.4e-46  142.5   0.0    6.1e-46  142.3   0.0    1.0  1  lcl|FitnessBrowser__Korea:Ga0059261_3985  Ga0059261_3985 methylmalonyl-CoA


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Korea:Ga0059261_3985  Ga0059261_3985 methylmalonyl-CoA epimerase (EC 5.1.99.1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  142.3   0.0   6.1e-46   6.1e-46       1     129 []       6     134 ..       6     134 .. 0.96

  Alignments for each domain:
  == domain 1  score: 142.3 bits;  conditional E-value: 6.1e-46
                                 TIGR03081   1 kldhvaiavkdleeaaklyrdvlGakvsee.eelpeqgvkvvflelgetklellepleedspiakflek 68 
                                               +l+h+++a++++e+ +++yrdv+Ga+  ++  +lp qgvkv f++  +t++el+epl+ dspi +fl++
  lcl|FitnessBrowser__Korea:Ga0059261_3985   6 RLNHIGVATPSIEASVAFYRDVMGAQTIHApFDLPAQGVKVCFVDTPNTQIELIEPLGADSPIHGFLAR 74 
                                               79***********************98886268************************************ PP

                                 TIGR03081  69 kkgeGlhhialevddieaaletlkekgvrlldeepriGahGkkvaFlhPkdtgGvLielee 129
                                               ++++G hh+++ev di++a +  + kg ++l+ epriGahG ++ F+hPkd+gGvL+e++e
  lcl|FitnessBrowser__Korea:Ga0059261_3985  75 NPAGGQHHVCYEVPDIHEAKAWFEAKGAKVLG-EPRIGAHGTPIFFVHPKDMGGVLTEIME 134
                                               *****************************998.6************************976 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (129 nodes)
Target sequences:                          1  (141 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 5.24
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory