Align Aminomethyltransferase (EC 2.1.2.10) (characterized)
to candidate Ga0059261_3256 Ga0059261_3256 glycine cleavage system T protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5556 (374 letters) >FitnessBrowser__Korea:Ga0059261_3256 Length = 389 Score = 340 bits (872), Expect = 4e-98 Identities = 193/378 (51%), Positives = 245/378 (64%), Gaps = 13/378 (3%) Query: 4 EQLLKTPLHALHLELGARMVPFAGYDMPVQYPLGVMKEHQHTRDQAGLFDVSHMGQIRLT 63 E+L PL A H G RMVPFAGY+MPVQY G+M EH R+ AGLFDVSHMGQ+ L+ Sbjct: 12 EELALLPLDAWHRAKGGRMVPFAGYEMPVQYE-GIMAEHLWVRESAGLFDVSHMGQLFLS 70 Query: 64 GAGAAKALETLVPVDIIDLPVGMQRYAMFTNENGGILDDLMV--------ANLGNDELFL 115 G G ALE L+P D+ + V Q+Y++ +NGGILDDLM A+ G L++ Sbjct: 71 GDGLDAALEALIPADVAGVKVNGQKYSLLLAQNGGILDDLMFTRWDADNGAHPGAAGLYM 130 Query: 116 VVNAACKDQDLAHLRAHIGAQCSIEPLFEARALLALQGPAAVTVLARLAPDVAKMTFMQF 175 VVN ACK D+AHLR H+ + I + E ALLALQGP AV L+RL P V + FM+ Sbjct: 131 VVNGACKWDDIAHLREHLPDEIEINHMDE-HALLALQGPKAVDALSRLVPGVEGLIFMRG 189 Query: 176 QRVTLLGMDCYVSRSGYTGEDGFEISVPAAEAEKLARALLAEPEVAAIGLGARDSLRLEA 235 R G ++SRSGYTGEDGFEISV A +A LA AL A+PEV IGLGARDSLRLEA Sbjct: 190 GRFDWNGTSLWISRSGYTGEDGFEISVEADKAAALAGALTAQPEVKPIGLGARDSLRLEA 249 Query: 236 GLCLYGHDMNTETTPIEASLLWAISKVRRADGARAGGFPGAETVFAQQQGGVKRKRVGLL 295 L LYGHD++TETTPI A+L +A++ RR + A FPGAE + +++ G ++RVGL+ Sbjct: 250 DLPLYGHDLDTETTPIMAALNFAVASKRRREEA---NFPGAERILLEREQGAIQRRVGLI 306 Query: 296 PQERTPVREGAEIVNEAGEIIGTVCSGGFGPTLGGPLAMGYLDSAYVALDTPVWAIVRGK 355 + R PVREGA ++++ G +G V SGGF PT+ P+AM Y+ +A + T V RGK Sbjct: 307 VEGRQPVREGALVLDDEGNEVGRVTSGGFAPTVQKPIAMAYVPTAMAEVGTRVTLSQRGK 366 Query: 356 KVPLLVSKMPFVPQRYYR 373 V MPFVP Y R Sbjct: 367 IHHGEVVPMPFVPHNYVR 384 Lambda K H 0.321 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 389 Length adjustment: 30 Effective length of query: 344 Effective length of database: 359 Effective search space: 123496 Effective search space used: 123496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate Ga0059261_3256 Ga0059261_3256 (glycine cleavage system T protein)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.11339.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-104 333.1 0.0 1.1e-103 332.8 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_3256 Ga0059261_3256 glycine cleavage Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_3256 Ga0059261_3256 glycine cleavage system T protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 332.8 0.0 1.1e-103 1.1e-103 6 361 .. 19 379 .. 15 380 .. 0.93 Alignments for each domain: == domain 1 score: 332.8 bits; conditional E-value: 1.1e-103 TIGR00528 6 LydlhtelggklvdfaGwelPvqykslieeheavrtkaGlfDvshmgkvelsGskslkfLqrllanDvd 74 L h gg++v+faG+e+Pvqy++++ eh +vr++aGlfDvshmg+ lsG+ ++L+ l+++Dv+ lcl|FitnessBrowser__Korea:Ga0059261_3256 19 LDAWHRAKGGRMVPFAGYEMPVQYEGIMAEHLWVRESAGLFDVSHMGQLFLSGDGLDAALEALIPADVA 87 66678999************************************************************* PP TIGR00528 75 aLtkGkaqysvllnaqGGvvDDlivykeged.......nrfllvvnaataekDlewlkehleeevtldt 136 + + +ys ll +GG++DDl+ ++ d +++vvn a++ D ++l+ehl++e++++ lcl|FitnessBrowser__Korea:Ga0059261_3256 88 GVKVNGQKYSLLLAQNGGILDDLMFTRWDADngahpgaAGLYMVVNGACKWDDIAHLREHLPDEIEIN- 155 ****999******************9987775777765579*********************999875. PP TIGR00528 137 lskeisllalqGPkaktiledlldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekav 205 ++e +llalqGPka + l l+ vegl + + + + + i+r+GytGedGfei+v+ +ka+ lcl|FitnessBrowser__Korea:Ga0059261_3256 156 HMDEHALLALQGPKAVDALSRLVP-GVEGLIFM-RGGRFDWNGTSLWISRSGYTGEDGFEISVEADKAA 222 67899***********99988864.46666433.344777777788*********************** PP TIGR00528 206 elwkklveaygvkPiGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkker..kksdfiGravle 272 l+ +l +++ vkPiGLgarD+Lrlea+++LyG++ld e+tP+ a+l+++v+ +r ++ +f G + + lcl|FitnessBrowser__Korea:Ga0059261_3256 223 ALAGALTAQPEVKPIGLGARDSLRLEADLPLYGHDLDTETTPIMAALNFAVASKRrrEEANFPGAERIL 291 ***************************************************998766899********* PP TIGR00528 273 eqkengtekklvGlemlekgiarnelkvlltngekevGivtsGtlsPtLgknialayvdkelekiGtkl 341 +e+g+ +++vGl + ++ r++ vl +g +evG vtsG ++Pt++k ia+ayv++ ++++Gt++ lcl|FitnessBrowser__Korea:Ga0059261_3256 292 LEREQGAIQRRVGLIVEGRQPVREGALVLDDEG-NEVGRVTSGGFAPTVQKPIAMAYVPTAMAEVGTRV 359 ******************************888.99********************************* PP TIGR00528 342 evevrnklvkikvvkklfvr 361 + r+k+ + +vv ++fv+ lcl|FitnessBrowser__Korea:Ga0059261_3256 360 TLSQRGKIHHGEVVPMPFVP 379 ******************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (389 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.66 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory