Align Hydroxyacylglutathione hydrolase; EC 3.1.2.6; Glyoxalase II; Glx II (uncharacterized)
to candidate Ga0059261_0945 Ga0059261_0945 Zn-dependent hydrolases, including glyoxylases
Query= curated2:Q2RP80 (256 letters) >FitnessBrowser__Korea:Ga0059261_0945 Length = 288 Score = 92.4 bits (228), Expect = 9e-24 Identities = 67/193 (34%), Positives = 84/193 (43%), Gaps = 35/193 (18%) Query: 18 YLVRCRATGACAVIDP-------------SLAEPVLAAAESLGWTITHILNTHHHYDHTG 64 YLV ATG AVIDP + + VLAAA+S GW I +L TH H DH Sbjct: 18 YLVADPATGEAAVIDPVHDFDPASGVIDSASVDRVLAAADSHGWRIVMVLETHAHADHLS 77 Query: 65 GNEEIKAATGC----------------EIIGFAGDAHRLPGIDRTVVEGDRVAIGQAEAR 108 G IK+ TG + FA DR +GDR +G Sbjct: 78 GAPLIKSRTGAWVGIGEHIRDVQKIFRPVFNFADLQTDGSDFDRLFADGDRFTLGTLPVE 137 Query: 109 VIETPGHTLGHIAYWFAESSALFCGDTLFSAGCGRLFE----GSAGQMWDSLRKLRALPA 164 VI PGHT +AY + A+F GDTLF G G A ++ S+R+L LP Sbjct: 138 VIHVPGHTPADVAYRIGD--AVFVGDTLFMPDYGTARTDFPGGDARILYRSIRRLLTLPD 195 Query: 165 QTLVFCGHEYTQP 177 T +F H+Y P Sbjct: 196 DTRLFLCHDYKAP 208 Lambda K H 0.322 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 288 Length adjustment: 25 Effective length of query: 231 Effective length of database: 263 Effective search space: 60753 Effective search space used: 60753 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory