Align palmitoyl-CoA hydrolase (EC 3.1.2.2) (characterized)
to candidate Ga0059261_1822 Ga0059261_1822 S-formylglutathione hydrolase
Query= BRENDA::P33018 (278 letters) >FitnessBrowser__Korea:Ga0059261_1822 Length = 279 Score = 279 bits (713), Expect = 6e-80 Identities = 132/278 (47%), Positives = 188/278 (67%), Gaps = 4/278 (1%) Query: 1 MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPPRDHTPPPVLYWLSGLTCNDENFT 60 +E L ++ +G Q +RH S+ PMTFS+F+P + PVL++LSGLTC N T Sbjct: 3 LETLSTNKAHDGTQGVYRHASTATGTPMTFSVFVPDHAEGAKLPVLWYLSGLTCTHANVT 62 Query: 61 TKAGAQRVAAELGIVLVMPDTSPRGEKVANDDGYDLGQGAGFYLNATQPPWATHYRMYDY 120 K + AE G++ + PDTSPRG+ V +D+ YD G+GAGFY++AT+ PWA ++RM Y Sbjct: 63 EKGEYRAACAEHGVIFIAPDTSPRGDAVPDDEAYDFGKGAGFYVDATEEPWAANFRMRSY 122 Query: 121 LRDELPALVQSQFNVSD--RCAISGHSMGGHGALIMALKNPGKYTSVSAFAPIVNPCSVP 178 + DELPAL+ +F +D R I+GHSMGGHGAL + L+NP ++ SVSAFAPI P P Sbjct: 123 VEDELPALILREFPQADLSRQGITGHSMGGHGALTIGLRNPDRFRSVSAFAPICAPSQCP 182 Query: 179 WGIKAFSSYLGEDKNAWLEWDSCALMYASNAQDAIPTLIDQGDNDQFLADQLQPAVLAEA 238 WG KA + YLG D+ W +D+CA++ ++ L+DQGD D FL++QL+P +LA+A Sbjct: 183 WGEKALTGYLGGDREDWRAYDACAMI--ADGLRIAELLVDQGDADAFLSEQLKPELLAQA 240 Query: 239 ARQKAWPMTLRIQPGYDHSYYFIASFIEDHLRFHAQYL 276 + +TLR+QPGYDHSYYFI++F+ +H+ +HA L Sbjct: 241 CQDAGIDLTLRMQPGYDHSYYFISTFLPEHVAWHAARL 278 Lambda K H 0.320 0.136 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 279 Length adjustment: 25 Effective length of query: 253 Effective length of database: 254 Effective search space: 64262 Effective search space used: 64262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory