Align Hydroxyacylglutathione hydrolase GloC; Accessory type II glyoxalase; Glyoxalase II 2; GlxII-2; EC 3.1.2.6 (characterized)
to candidate Ga0059261_2228 Ga0059261_2228 Zn-dependent hydrolases, including glyoxylases
Query= SwissProt::P75849 (215 letters) >FitnessBrowser__Korea:Ga0059261_2228 Length = 223 Score = 234 bits (598), Expect = 7e-67 Identities = 103/206 (50%), Positives = 139/206 (67%), Gaps = 1/206 (0%) Query: 5 IIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLDHVGA 64 I+PVT QN +L+WC +T A DPGGD +++K G+T+ ++L+THGH+DH G Sbjct: 13 IVPVTPLQQNSTLLWCTETMRGAFTDPGGDLDRLKAAAQQHGVTIEKLLITHGHIDHCGQ 72 Query: 65 AAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEECQPLTPDRWLNEGDTISIGNVTL 124 A LA+ GVP+ GP + D FW+ L R +G++ +P PDRWL +GDT+++GN+TL Sbjct: 73 AGMLAKELGVPIEGPHEADRFWISRLDDDGRKYGIDG-KPFEPDRWLVDGDTVTVGNLTL 131 Query: 125 QVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKLLPLGD 184 V HCPGHTPGHVVF +KL I GDVIF+G +GR+DFP G+H L+ +I KL PLG Sbjct: 132 DVYHCPGHTPGHVVFHHAPSKLAIVGDVIFQGSIGRTDFPMGNHQDLLDAITGKLWPLGG 191 Query: 185 DVIFIPGHGPLSTLGYERLHNPFLQD 210 D +F+PGHG S ER NPF+ D Sbjct: 192 DTVFVPGHGQPSNFAQERRTNPFVAD 217 Lambda K H 0.321 0.142 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 223 Length adjustment: 22 Effective length of query: 193 Effective length of database: 201 Effective search space: 38793 Effective search space used: 38793 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory