Align hydroxyacylglutathione hydrolase; EC 3.1.2.6 (characterized)
to candidate Ga0059261_2759 Ga0059261_2759 hydroxyacylglutathione hydrolase
Query= CharProtDB::CH_024825 (251 letters) >FitnessBrowser__Korea:Ga0059261_2759 Length = 242 Score = 176 bits (445), Expect = 5e-49 Identities = 94/222 (42%), Positives = 135/222 (60%), Gaps = 4/222 (1%) Query: 6 IPAFDDNYIWVLNDEA-GRCLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKE 64 IPA DNYIW+ +D+A G+ ++VDP AEPVL A AA W +AI+ TH H DH GG Sbjct: 7 IPALSDNYIWLAHDDASGQTIVVDPAQAEPVLAAAAARGWTIDAIWNTHWHPDHTGGNAA 66 Query: 65 LVEKFPQIVVYGPQETQDKGTT-QVVKDGETAFVLGHEFSVIATPGHTLGHICYF--SKP 121 + + V+ E T ++V +G+ + H SV+ P HT GHI Y+ + Sbjct: 67 IKDATGCTVIAPSAEAAKIPTADRLVAEGDVVKLGDHAASVLEVPAHTAGHIAYYLPDES 126 Query: 122 YLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILPH 181 +F GDTLF+ GCGRLFEGTA QM+ ++++L+ALP DT V CAHEYT SN ++AL P Sbjct: 127 VVFVGDTLFAMGCGRLFEGTAEQMFANMQRLAALPGDTTVYCAHEYTQSNGRYALVAEPD 186 Query: 182 DLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDID 223 + ++ + +V +RA+ T+P ++ ER N F+R E + Sbjct: 187 NEALAERMAQVDMMRAQGLPTVPTTIELERATNPFMRAESAE 228 Lambda K H 0.321 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 242 Length adjustment: 24 Effective length of query: 227 Effective length of database: 218 Effective search space: 49486 Effective search space used: 49486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
Align candidate Ga0059261_2759 Ga0059261_2759 (hydroxyacylglutathione hydrolase)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.26680.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-100 319.9 0.0 5.9e-100 319.7 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_2759 Ga0059261_2759 hydroxyacylglutat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_2759 Ga0059261_2759 hydroxyacylglutathione hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 319.7 0.0 5.9e-100 5.9e-100 2 226 .. 5 232 .. 4 241 .. 0.97 Alignments for each domain: == domain 1 score: 319.7 bits; conditional E-value: 5.9e-100 TIGR03413 2 iaipalsdNyiwllkdeks.eavvvDpgeaepvlealeekglkleaillTHhHaDHvggvaellekfpv 69 ++ipalsdNyiwl +d++s +++vvDp++aepvl+a++++g++++ai++TH+H DH+gg+a++++++++ lcl|FitnessBrowser__Korea:Ga0059261_2759 5 VRIPALSDNYIWLAHDDASgQTIVVDPAQAEPVLAAAAARGWTIDAIWNTHWHPDHTGGNAAIKDATGC 73 78*****************9************************************************* PP TIGR03413 70 kvvgpaee..ripgltkevkegdevellelevevlevpGHtlgHiayyleeekvlFcgDtLfsaGCGrl 136 +v++p++e +ip++++ v+egd v+l++++++vlevp+Ht+gHiayyl++e+v+F+gDtLf++GCGrl lcl|FitnessBrowser__Korea:Ga0059261_2759 74 TVIAPSAEaaKIPTADRLVAEGDVVKLGDHAASVLEVPAHTAGHIAYYLPDESVVFVGDTLFAMGCGRL 142 ******99999********************************************************** PP TIGR03413 137 fegtaeqmleslqklaaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealrakgkptlPst 205 fegtaeqm++ +q+laaLp +t+vycaHEYt+sN r+al +ep+neal+er+++v+ +ra+g pt+P+t lcl|FitnessBrowser__Korea:Ga0059261_2759 143 FEGTAEQMFANMQRLAALPGDTTVYCAHEYTQSNGRYALVAEPDNEALAERMAQVDMMRAQGLPTVPTT 211 ********************************************************************* PP TIGR03413 206 laeekatNpFLraeeaevkaa 226 ++ e+atNpF+rae+ae a+ lcl|FitnessBrowser__Korea:Ga0059261_2759 212 IELERATNPFMRAESAEQLAK 232 *************99876444 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (242 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 8.71 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory