Align L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 (uncharacterized)
to candidate Ga0059261_1819 Ga0059261_1819 S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
Query= curated2:Q65JE7 (346 letters) >FitnessBrowser__Korea:Ga0059261_1819 Length = 370 Score = 111 bits (278), Expect = 3e-29 Identities = 106/348 (30%), Positives = 161/348 (46%), Gaps = 40/348 (11%) Query: 31 EVLIKVKAASICGTDVHIYNWDEWAKSRVKPPYVFGHEFSGEVVQVGENVTTVKEGEYVS 90 EVL+++ A IC TD Y D + + P V GHE +G V +VG VT++K G++V Sbjct: 29 EVLVEIMATGICHTDA--YTLDGFDSEGIFPS-VLGHEGAGVVREVGAGVTSLKPGDHVI 85 Query: 91 AETHIVCGKCLPCLTGKEHVC---KKTLILGVDTDGCFA-EYVKMP-----AANIWKNPA 141 C +C CL+GK ++C + T G+ DG Y P + + N Sbjct: 86 PLYTPECRQCKSCLSGKTNLCTAIRATQGKGLMPDGTTRFSYKGQPIFHYMGCSTFSNST 145 Query: 142 GMPE-DLASIQE--PLGNAVHT---VLTGMTA---------GVKVAVVGCGPIGLMAVAV 186 +PE LA I+E P + + V TG+ A G V V G G IGL + Sbjct: 146 VLPEIALAKIREDAPFQTSCYIGCGVTTGVGAVVNTAKVQVGETVVVFGLGGIGLNVIQG 205 Query: 187 AKASGAAQVIAIDKNEYRLDLALQMGATDIIS---VEKEDPLKNVSALTNGEGADLVCEM 243 AK GA ++ +D N R + + G T I+ +ED + V ALT+G GAD + Sbjct: 206 AKMVGADVIVGVDINPDREEWGRKFGMTHFINGKGKSREDVIAEVLALTDG-GADYSFDA 264 Query: 244 SGHPTAIRQSLKMAANG-GRVHVLSLPEHPVCI-----DMTNDIVFKGLTVQGITGRKMF 297 +G+ +R +L+ G G ++ + E I + V+KG G GR Sbjct: 265 TGNTEVMRTALECCHRGWGESIIIGVAEAGKEIATRPFQLVTGRVWKGTAFGGAKGRTDV 324 Query: 298 ETWRQVSGLLQSGTIQIKPVITHRFPMEEFEKGFELMRKGQCGKVVLI 345 ++ +G I I P+ITH +EE KGF+LM G+ + V++ Sbjct: 325 P---KIVDWYMNGKIAIDPMITHVLSLEEINKGFDLMHAGESIRSVVV 369 Lambda K H 0.318 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 370 Length adjustment: 29 Effective length of query: 317 Effective length of database: 341 Effective search space: 108097 Effective search space used: 108097 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory