GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Sphingomonas koreensis DSMZ 15582

Align Putative aldehyde dehydrogenase FUS7; Fusarin biosynthesis protein 7; EC 1.2.1.3 (characterized)
to candidate Ga0059261_1680 Ga0059261_1680 NAD-dependent aldehyde dehydrogenases

Query= SwissProt::S0ENH1
         (461 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_1680 Ga0059261_1680
           NAD-dependent aldehyde dehydrogenases
          Length = 469

 Score =  323 bits (828), Expect = 7e-93
 Identities = 169/462 (36%), Positives = 264/462 (57%), Gaps = 9/462 (1%)

Query: 9   IITGQPRSARETTSGVNPLDRSSLWPAPVATGNDVEEAVRSAQEAFPAWSEKTYKQRTEL 68
           I+ G+P +  ET   ++P        AP+A+  D++ AV +A+ AFP W+    + R   
Sbjct: 7   IVDGKPLAMAETFPVIDPATGRPFADAPLASTADLDAAVAAARRAFPGWAATPIEDRAAA 66

Query: 69  LEKFADLYLVHANEFCQLIATECGRTAGNAAIEVYVAAQWLRYPSKYEIPEEVTEDEKKT 128
           +   AD      +E  +L++ E G+   NA  E+  A  W R  +      +V +D+   
Sbjct: 67  ILAIADSIEAAKDELARLLSAEQGKPVPNAVGEIMGALAWARATAGLRPAVDVLKDDDSV 126

Query: 129 SIVTH-EPLGVVAAICPWNFPLMLALGKIAPALATGNCVILKPSPFTPYSSLKLVELAQQ 187
            +  H +PLGVVA+I PWNFP+M+A+  I P L  GN V++KPS FTP ++L++VE+A  
Sbjct: 127 RVEVHRKPLGVVASISPWNFPVMIAIWHIIPGLVAGNTVVMKPSSFTPLAALRMVEIANA 186

Query: 188 VFPPSVLQVLHGHDDLGPMLVKHPRIQKITFTGSTTTGKQILRDAAETMKRVTLETAGNN 247
             PP VL  + G  ++G  +  HP I KI FTGST TG+ I+ D A  +KR+TLE  GN+
Sbjct: 187 HLPPGVLNSVTGEVEIGRAIASHPGIDKIVFTGSTPTGRSIMADGAANLKRLTLELGGND 246

Query: 248 ASIILPDVNIEAVIPQLAGGLWFNAGQVCIATRRMYIHQDIFDEAVAQLAEASK------ 301
           A+I+LPD +++ V  ++    + N+GQ+C A +R+Y+H+ I D    +LAE ++      
Sbjct: 247 AAIVLPDADVDKVAAKIFAKAFGNSGQICAAVKRVYVHESIHDALAEKLAEMARTAVVGP 306

Query: 302 --DLASGMEPIQNEMQLVRLQQALSDANAAGCELLSLGKTEAAEGFFIQPTILKSPPPDA 359
             D AS   P+QN  Q   ++    DA A G   L+ G+    +G+F   +++       
Sbjct: 307 GSDAASQFGPVQNRKQFDLVRALADDARAHGGRFLAGGEAREGDGYFFPLSVVVDVTDGM 366

Query: 360 DVVQQENFGPIVSCIKFSSLDEAISLANNSDTGLAASVWSSDVSAARRVAAKLEVGNVYI 419
            +V +E FGPI+  I++S  ++A++ AN ++ GL  SVWS+D +AA   A +LE G V++
Sbjct: 367 RIVDEEQFGPILPVIRYSDPEDALARANANENGLGGSVWSADPAAALAFAQRLEAGTVWV 426

Query: 420 NGPPQPDPYVPFGGHKQSGLGVEYGLPGLLSFCQTKSTYLYK 461
           N      P VPFGG KQSG+G E+GL GL  + Q ++  + K
Sbjct: 427 NDHASISPDVPFGGAKQSGVGTEFGLYGLEEYMQLQTVRVAK 468


Lambda     K      H
   0.316    0.132    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 501
Number of extensions: 14
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 461
Length of database: 469
Length adjustment: 33
Effective length of query: 428
Effective length of database: 436
Effective search space:   186608
Effective search space used:   186608
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory