Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate Ga0059261_1321 Ga0059261_1321 ABC-type antimicrobial peptide transport system, ATPase component
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__Korea:Ga0059261_1321 Length = 238 Score = 116 bits (291), Expect = 5e-31 Identities = 79/221 (35%), Positives = 121/221 (54%), Gaps = 5/221 (2%) Query: 4 IIVKNVSKVFKKGKVV--ALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGE 61 I ++N++KVF +G AL V+++I + ++GPSG+GK+T M I+ LDVP++GE Sbjct: 8 IRLRNITKVFGEGATAFQALKGVDLDIAERDFVAVMGPSGSGKSTTMNILGCLDVPTSGE 67 Query: 62 LYFDDRLVASNGKLIVPPEDRK-IGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKR 120 F + + + RK +G VFQ + L A EN+ PL K+ + Sbjct: 68 FLFKGVYIETLDRDQRALVRRKYLGFVFQGFNLLSRTNALENVELPLLYRGEDKKVRHEL 127 Query: 121 VEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSAR 180 + + + +H P ELSGGQ QRVA+ARA+V P++LL DEP NLD+ Sbjct: 128 GMAALEKVGLADWWDHTPAELSGGQPQRVAIARAIVTSPAVLLADEPTGNLDSARSVEIM 187 Query: 181 ALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQ 221 L+ + G+T+L+V+H+P D+ A A R V K LV+ Sbjct: 188 ELLTSLNKDSGITVLMVTHEP-DMAAFA-RTIVHFKDGLVE 226 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 238 Length adjustment: 26 Effective length of query: 327 Effective length of database: 212 Effective search space: 69324 Effective search space used: 69324 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory